Stock Number Hs1508

Human Gene: OTX1


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
OTX1 orthodenticle homeobox 1 HGNC:8521 2p15 oc X

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03174 pGW-HA.attB ENST00000282549.6 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK37166209484897

Sequences

DNA sequence (1296 bp) Protein sequence (432 aa)
ATGATGTCTTACCTCAAACAACCCCCATACGGCATGAACGGGCTGGGCCT
GGCCGGGCCCGCCATGGACCTCCTGCACCCATCCGTGGGCTATCCGGCCA
CTCCGCGGAAGCAGCGGCGGGAGCGCACCACCTTCACGCGTTCACAGCTG
GACGTGCTCGAGGCGCTCTTCGCCAAGACTCGCTACCCTGACATCTTCAT
GCGGGAGGAGGTGGCGCTCAAGATCAACCTGCCGGAGTCTAGAGTCCAGG
TCTGGTTCAAGAACCGCCGCGCCAAATGCCGCCAGCAGCAGCAGAGCGGG
AGCGGAACCAAGAGCCGCCCAGCCAAGAAGAAGTCCTCTCCAGTGCGGGA
GAGCTCGGGCTCCGAAAGCAGTGGCCAATTCACGCCGCCAGCTGTGTCCA
GCTCTGCCTCGTCCTCTAGCTCGGCGTCCAGCTCTTCCGCCAACCCAGCG
GCTGCAGCGGCTGCGGGACTAGGTGGGAACCCGGTGGCGGCCGCGTCGTC
GCTGAGTACACCAGCTGCCTCATCTATCTGGAGCCCGGCCTCCATCTCGC
CAGGCTCAGCGCCCGCGTCCGTGTCGGTGCCGGAGCCATTGGCCGCGCCT
AGCAACACCTCGTGTATGCAGCGCTCCGTAGCTGCAGGCGCCGCCACCGC
AGCAGCCTCTTATCCCATGTCCTACGGCCAGGGCGGCAGCTACGGCCAAG
GCTACCCTACGCCCTCCTCTTCCTACTTTGGCGGCGTGGACTGCAGCTCA
TACCTAGCGCCCATGCACTCACATCACCACCCGCACCAGCTGAGCCCCAT
GGCACCCTCCTCCATGGCGGGCCACCATCATCACCACCCACATGCGCACC
ACCCGTTGAGCCAGTCCTCAGGCCACCACCACCACCATCACCACCACCAC
CACCAAGGCTACGGTGGCTCTGGGCTTGCCTTCAACTCTGCCGACTGCTT
GGATTACAAGGAGCCTGGCGCCGCTGCTGCTTCCTCCGCCTGGAAACTCA
ACTTCAACTCCCCCGACTGTCTGGACTATAAGGACCAAGCCTCATGGCGG
TTCCAGGTCTTGTGCCCAACTTTCTTGTACAAAGTGGTGGTACCTCGAAG
TTCCTATTCTCTACTTAGTATAGGAACTTCCATCCTTGGAGCTCCTTCAG
GAGGCGGTGCTACTGCTGGCGCTGGTGGAGCCGGTGGACCTGCGGGGTTA
ATTTACCCATACGATGTTCCTGACTATGCGGGCTATCCCTATGACGTCCC
GGACTATGCAGGATCCTATCCATATGACGTTCCAGATTACGCTTGA
MMSYLKQPPYGMNGLGLAGPAMDLLHPSVGYPATPRKQRRERTTFTRSQL
DVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQSG
SGTKSRPAKKKSSPVRESSGSESSGQFTPPAVSSSASSSSSASSSSANPA
AAAAAGLGGNPVAAASSLSTPAASSIWSPASISPGSAPASVSVPEPLAAP
SNTSCMQRSVAAGAATAAASYPMSYGQGGSYGQGYPTPSSSYFGGVDCSS
YLAPMHSHHHPHQLSPMAPSSMAGHHHHHPHAHHPLSQSSGHHHHHHHHH
HQGYGGSGLAFNSADCLDYKEPGAAAASSAWKLNFNSPDCLDYKDQASWR
FQVLCPTFLYKVVVPRSSYSLLSIGTSILGAPSGGGATAGAGGAGGPAGL
IYPYDVPDYAGYPYDVPDYAGSYPYDVPDYA*

Index