Stock Number Hs1507

Human Gene: ETV7


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
ETV7 ETS variant 7 HGNC:18160 6p21.31 aop 2L

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03121 pGW-HA.attB ENST00000538992.3 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK33166209384896

Sequences

DNA sequence (1257 bp) Protein sequence (419 aa)
ATGCAGGAGGGAGAATTGGCTATTTCTCCTATAAGCCCTGTGGCAGCCAT
GCCTCCCCTAGGCACCCACGTGCAAGCCAGATGTGAAGCTCAAATTAACC
TGCTGGGTGAAGGGGGGATCTGCAAGCTGCCAGGAAGACTCCGCATCCAG
CCCGCACTGTGGAGCAGGGAGGACGTGCTGCACTGGCTGCGCTGGGCAGA
GCAGGAGTACTCTCTGCCATGCACCGCGGAGCACGGGTTCGAGATGAACG
GACGCGCCCTCTGCATCCTCACCAAGGACGACTTCCGGCACCGTGCGCCC
AGCTCAGGTGACGTCCTGTATGAGCTGCTCCAGTACATCAAGACCCAGCG
GCGAGCCCTGGTGTGTGGACCCTTTTTTGGAGGGATCTTCAGGCTGAAGA
CGCCCACCCAGCACTCTCCAGTCCCCCCGGAAGAGGTGACTGGCCCCTCT
CAGATGGACACCCGAAGGGGCCACCTGCTGCAGCCACCAGACCCAGGGCT
TACCAGCAACTTCGGCCACCTGGATGACCCTGGCCTGGCAAGGTGGACCC
CTGGCAAGGAGGAGTCCCTCAACTTATGTCACTGTGCAGAGCTCGGCTGC
AGGACCCAGGGGGTCTGTTCCTTCCCCGCGATGCCGCAGGCCCCCATTGA
CGGCAGGATCGCTGACTGCCGCCTGCTGTGGGATTACGTGTATCAGCTGC
TCCTTGATACCCGATATGAGCCCTACATCAAGTGGGAAGACAAGGACGCC
AAGATCTTCCGAGTTGTGGATCCAAATGGGCTCGCCAGACTCTGGGGAAA
TCACAAGAACCGGGTGAACATGACCTACGAGAAGATGTCTCGTGCCCTGC
GCCACTATTATAAGCTTAATATCATTAAGAAGGAACCGGGGCAGAAACTC
CTGTTCAGATTTCTAAAGACTCCGGGAAAGATGGTCCAGGACAAGCACAG
CCACCTGGAGCCGCTGGAGAGCCAGGAGCAGGACAGAATAGAGTTCAAGG
ACAAGAGGCCAGAAATCTCTCCGTGCCCAACTTTCTTGTACAAAGTGGTG
GTACCTCGAAGTTCCTATTCTCTACTTAGTATAGGAACTTCCATCCTTGG
AGCTCCTTCAGGAGGCGGTGCTACTGCTGGCGCTGGTGGAGCCGGTGGAC
CTGCGGGGTTAATTTACCCATACGATGTTCCTGACTATGCGGGCTATCCC
TATGACGTCCCGGACTATGCAGGATCCTATCCATATGACGTTCCAGATTA
CGCTTGA
MQEGELAISPISPVAAMPPLGTHVQARCEAQINLLGEGGICKLPGRLRIQ
PALWSREDVLHWLRWAEQEYSLPCTAEHGFEMNGRALCILTKDDFRHRAP
SSGDVLYELLQYIKTQRRALVCGPFFGGIFRLKTPTQHSPVPPEEVTGPS
QMDTRRGHLLQPPDPGLTSNFGHLDDPGLARWTPGKEESLNLCHCAELGC
RTQGVCSFPAMPQAPIDGRIADCRLLWDYVYQLLLDTRYEPYIKWEDKDA
KIFRVVDPNGLARLWGNHKNRVNMTYEKMSRALRHYYKLNIIKKEPGQKL
LFRFLKTPGKMVQDKHSHLEPLESQEQDRIEFKDKRPEISPCPTFLYKVV
VPRSSYSLLSIGTSILGAPSGGGATAGAGGAGGPAGLIYPYDVPDYAGYP
YDVPDYAGSYPYDVPDYA*

Index