Stock Number Hs1506

Human Gene: RHOBTB2


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
RHOBTB2 Rho related BTB domain containing 2 HGNC:18756 8p21.3 RhoBTB 3L

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03527 pGW-HA.attB ENST00000251822.6 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK37166209284895

Sequences

DNA sequence (2415 bp) Protein sequence (805 aa)
ATGGATTCTGACATGGATTATGAAAGGCCAAACGTAGAGACCATCAAGTG
CGTTGTGGTGGGGGACAACGCCGTGGGTAAGACCAGGCTCATCTGTGCCC
GCGCTTGCAATGCCACCCTCACCCAGTACCAGCTGCTGGCCACGCATGTG
CCCACAGTATGGGCCATCGACCAATATCGTGTGTGCCAGGAGGTGCTGGA
ACGCTCCCGAGACGTGGTAGATGATGTCAGCGTCTCTCTGCGCCTCTGGG
ACACCTTTGGAGACCACCACAAAGACCGTCGCTTTGCTTATGGGAGATCT
GATGTGGTGGTTCTGTGCTTCTCCATTGCCAACCCCAATTCCCTCCACCA
TGTCAAGACCATGTGGTACCCAGAAATCAAGCACTTCTGCCCCCGAGCAC
CTGTCATCTTGGTGGGCTGCCAGTTGGACCTGCGCTACGCTGACCTGGAG
GCTGTCAACAGGGCTAGGCGACCCTTGGCTAGGCCCATCAAACCTAATGA
AATCCTGCCCCCAGAGAAGGGTCGGGAGGTGGCCAAGGAGCTGGGCATCC
CCTACTATGAGACCAGCGTGGTGGCCCAGTTCGGCATCAAGGACGTCTTT
GACAACGCCATCCGAGCTGCACTCATCTCCCGCCGCCACCTGCAGTTCTG
GAAGTCCCACCTCCGCAATGTGCAGCGGCCTCTGCTGCAGGCACCCTTCC
TACCCCCCAAGCCACCGCCCCCGATCATCGTGGTGCCCGACCCTCCCTCC
AGCAGCGAGGAGTGCCCCGCCCACCTCCTGGAGGACCCGCTCTGCGCGGA
CGTCATCCTGGTGCTGCAGGAGCGGGTGCGCATCTTTGCCCACAAGATCT
ACCTCTCCACCTCCTCCTCCAAGTTCTATGACCTGTTCCTCATGGACCTG
AGTGAGGGGGAGCTGGGGGGCCCCTCGGAGCCAGGGGGCACCCACCCAGA
GGACCACCAGGGCCACTCTGATCAACACCACCACCATCACCACCACCACC
ATGGGCGAGACTTCCTGCTCCGAGCAGCCAGCTTTGACGTGTGCGAGAGC
GTGGATGAGGCTGGGGGCTCCGGTCCTGCTGGCCTCCGTGCTTCCACCAG
CGACGGGATCTTACGGGGCAACGGAACAGGGTACCTACCGGGCAGGGGTC
GTGTGCTGTCTTCCTGGAGCCGAGCTTTTGTGAGCATCCAGGAAGAGATG
GCAGAAGATCCTCTCACCTACAAATCCCGGCTGATGGTGGTGGTGAAGAT
GGACAGTTCCATCCAGCCGGGGCCCTTCCGGGCTGTCCTCAAGTACCTGT
ACACGGGGGAGCTAGATGAGAACGAGCGTGACCTCATGCACATTGCCCAC
ATTGCTGAGCTGCTCGAGGTCTTTGATCTGCGCATGATGGTGGCCAACAT
TCTCAACAATGAGGCCTTCATGAACCAGGAGATCACCAAGGCCTTCCACG
TCCGCCGGACCAACCGGGTTAAGGAGTGCTTGGCAAAAGGCACCTTCTCA
GATGTGACCTTCATCCTGGATGATGGCACCATCAGCGCCCACAAGCCCCT
GTTGATTTCCAGCTGTGACTGGATGGCTGCCATGTTTGGGGGGCCATTTG
TGGAGAGCTCCACCCGGGAGGTGGTGTTTCCCTACACAAGCAAGAGCTGC
ATGCGGGCCGTGCTGGAATACCTCTACACCGGCATGTTCACCTCCAGCCC
CGACCTGGATGACATGAAGCTCATCATTCTAGCCAACCGCCTCTGCCTGC
CACACCTGGTTGCCCTCACAGAGCAGTACACAGTGACCGGGCTGATGGAA
GCGACCCAGATGATGGTGGACATCGATGGGGACGTCCTTGTGTTCCTGGA
ACTGGCTCAGTTCCACTGTGCGTACCAGCTGGCCGACTGGTGTCTCCACC
ACATCTGCACCAACTACAACAACGTGTGCCGCAAGTTCCCCCGAGACATG
AAGGCCATGTCCCCAGAAAACCAGGAGTATTTCGAGAAGCATCGGTGGCC
ACCTGTGTGGTACCTGAAGGAGGAAGATCATTACCAGCGGGCACGGAAGG
AGCGTGAGAAGGAGGACTACCTCCACCTCAAGCGGCAGCCCAAACGGCGT
TGGCTCTTCTGGAACAGTCCATCCTCCCCGTCTTCCTCGGCAGCCTCCTC
CTCATCCCCATCTTCCTCCTCGGCTGTGGTCTGCCCAACTTTCTTGTACA
AAGTGGTGGTACCTCGAAGTTCCTATTCTCTACTTAGTATAGGAACTTCC
ATCCTTGGAGCTCCTTCAGGAGGCGGTGCTACTGCTGGCGCTGGTGGAGC
CGGTGGACCTGCGGGGTTAATTTACCCATACGATGTTCCTGACTATGCGG
GCTATCCCTATGACGTCCCGGACTATGCAGGATCCTATCCATATGACGTT
CCAGATTACGCTTGA
MDSDMDYERPNVETIKCVVVGDNAVGKTRLICARACNATLTQYQLLATHV
PTVWAIDQYRVCQEVLERSRDVVDDVSVSLRLWDTFGDHHKDRRFAYGRS
DVVVLCFSIANPNSLHHVKTMWYPEIKHFCPRAPVILVGCQLDLRYADLE
AVNRARRPLARPIKPNEILPPEKGREVAKELGIPYYETSVVAQFGIKDVF
DNAIRAALISRRHLQFWKSHLRNVQRPLLQAPFLPPKPPPPIIVVPDPPS
SSEECPAHLLEDPLCADVILVLQERVRIFAHKIYLSTSSSKFYDLFLMDL
SEGELGGPSEPGGTHPEDHQGHSDQHHHHHHHHHGRDFLLRAASFDVCES
VDEAGGSGPAGLRASTSDGILRGNGTGYLPGRGRVLSSWSRAFVSIQEEM
AEDPLTYKSRLMVVVKMDSSIQPGPFRAVLKYLYTGELDENERDLMHIAH
IAELLEVFDLRMMVANILNNEAFMNQEITKAFHVRRTNRVKECLAKGTFS
DVTFILDDGTISAHKPLLISSCDWMAAMFGGPFVESSTREVVFPYTSKSC
MRAVLEYLYTGMFTSSPDLDDMKLIILANRLCLPHLVALTEQYTVTGLME
ATQMMVDIDGDVLVFLELAQFHCAYQLADWCLHHICTNYNNVCRKFPRDM
KAMSPENQEYFEKHRWPPVWYLKEEDHYQRARKEREKEDYLHLKRQPKRR
WLFWNSPSSPSSSAASSSSPSSSSAVVCPTFLYKVVVPRSSYSLLSIGTS
ILGAPSGGGATAGAGGAGGPAGLIYPYDVPDYAGYPYDVPDYAGSYPYDV
PDYA*

Index