Stock Number Hs1505

Human Gene: ANKRD12


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
ANKRD12 ankyrin repeat domain 12 HGNC:29135 18p11.22 CG10984 3L

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO02963 pGW-HA.attB ENST00000585234.5 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK37166209184894

Sequences

DNA sequence (1224 bp) Protein sequence (408 aa)
ATGCCCAAATCTGGGTTCACAAAACCAATTCAGAGTGAAAATTCTGACAG
TGACAGCAATATGGTAGAGAAACCATATGGAAGAAAGAGTAAAGACAAGA
TTGCATCCTACAGCAAAACTCCAAAAATTGAACGAAGTGATGTGAGCAAG
GAGATGAAAGAGAAATCATCCATGAAACGTAAACTTCCTTTTACTATTAG
CCCATCAAGAAATGAAGAACGAGATTCAGACACAGATTCAGATCCAGGAC
ATACAAGTGAAAATTGGGGGGAGAGACTTATATCTTCTTACAGGACATAC
TCAGAGAAAGAAGGTCCAGAAAAGAAGAAGACAAAAAAGGAAGCTGGAAA
TAAGAAATCCACACCAGTTAGCATTCTTTTTGGTTATCCACTCTCTGAGC
GAAAACAGATGGCACTTCTTATGCAGATGACAGCAAGAGACAACAGTCCA
GATTCCACACCAAATCATCCATCACAAACAACGCCTGCCCAAAAGAAAAC
TCCCAGTTCTTCATCTCGACAGAAAGATAAAGTTAATAAAAGAAATGAAC
GTGGTGAAACTCCTTTACACATGGCTGCTATTCGAGGAGATGTGAAACAA
GTTAAAGAATTAATAAGTTTAGGGGCAAATGTGAATGTGAAAGATTTTGC
AGGTTGGACACCACTGCATGAAGCTTGCAATGTTGGATATTACGATGTTG
CTAAGATACTTATAGCAGCTGGAGCAGATGTTAACACACAAGGATTAGAT
GATGACACTCCACTCCATGATTCTGCTAGTAGTGGGCACAGAGATATAGT
AAAGCTGTTACTTCGTCACGGTGGAAATCCATTTCAAGCTAATAAACATG
GGGAGCGTCCAGTGGATGTAGCAGAAACAGAGGAGTTGGAGTTGCTACTA
AAAAGAGAGGTGCCTTTATCTGATGATGATGAAAGTTACACAGGATCCAG
CTACCAATTTGCAGGAAATGCCAAGCTCAGCGGAGCAAGTTGCCCAACTT
TCTTGTACAAAGTGGTGGTACCTCGAAGTTCCTATTCTCTACTTAGTATA
GGAACTTCCATCCTTGGAGCTCCTTCAGGAGGCGGTGCTACTGCTGGCGC
TGGTGGAGCCGGTGGACCTGCGGGGTTAATTTACCCATACGATGTTCCTG
ACTATGCGGGCTATCCCTATGACGTCCCGGACTATGCAGGATCCTATCCA
TATGACGTTCCAGATTACGCTTGA
MPKSGFTKPIQSENSDSDSNMVEKPYGRKSKDKIASYSKTPKIERSDVSK
EMKEKSSMKRKLPFTISPSRNEERDSDTDSDPGHTSENWGERLISSYRTY
SEKEGPEKKKTKKEAGNKKSTPVSILFGYPLSERKQMALLMQMTARDNSP
DSTPNHPSQTTPAQKKTPSSSSRQKDKVNKRNERGETPLHMAAIRGDVKQ
VKELISLGANVNVKDFAGWTPLHEACNVGYYDVAKILIAAGADVNTQGLD
DDTPLHDSASSGHRDIVKLLLRHGGNPFQANKHGERPVDVAETEELELLL
KREVPLSDDDESYTGSSYQFAGNAKLSGASCPTFLYKVVVPRSSYSLLSI
GTSILGAPSGGGATAGAGGAGGPAGLIYPYDVPDYAGYPYDVPDYAGSYP
YDVPDYA*

Index