Stock Number Hs1504

Human Gene: WDR5B


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
WDR5B WD repeat domain 5B HGNC:17826 3q21.1 wds X

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO02960 pGW-HA.attB ENST00000330689.5 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK37166209084893

Sequences

DNA sequence (1224 bp) Protein sequence (408 aa)
ATGGCAACCAAGGAGTCAAGAGACGCCAAAGCACAGTTGGCCCTCTCCTC
ATCGGCCAATCAGAGCAAGGAAGTGCCTGAAAACCCAAACTATGCTCTCA
AATGTACTCTTGTGGGACACACGGAAGCAGTGTCATCAGTTAAGTTTAGT
CCTAATGGAGAATGGCTAGCAAGTTCTTCTGCTGATAGGCTAATCATAAT
TTGGGGAGCATATGATGGAAAATATGAGAAAACACTCTATGGTCATAATT
TGGAAATATCGGATGTTGCCTGGTCATCAGATTCCAGTCGTCTTGTTTCT
GCCTCAGATGATAAAACTCTAAAATTATGGGATGTGAGATCTGGAAAATG
TTTGAAAACACTGAAGGGGCACAGTAATTATGTCTTTTGTTGTAACTTCA
ATCCGCCATCCAACCTTATAATCTCGGGATCTTTTGATGAGACTGTAAAA
ATATGGGAGGTGAAAACAGGAAAGTGTCTCAAGACTTTGTCTGCTCATTC
TGACCCAGTTTCTGCTGTTCATTTTAATTGTAGTGGGTCCTTGATAGTGT
CAGGTAGCTATGATGGCCTCTGTAGAATCTGGGATGCTGCATCAGGTCAG
TGTTTAAAAACGCTCGTTGATGACGATAACCCTCCTGTCTCTTTTGTAAA
ATTTTCTCCAAATGGTAAATACATTCTCACTGCAACTTTGGACAACACTC
TTAAACTATGGGATTATAGCAGAGGCAGGTGCCTGAAAACATACACTGGT
CATAAGAATGAGAAATATTGCATATTTGCCAATTTTTCAGTTACTGGTGG
AAAGTGGATTGTGTCTGGTTCCGAGGATAACCTGGTTTACATTTGGAACC
TTCAGACTAAAGAGATTGTGCAGAAATTACAAGGCCATACAGATGTTGTG
ATCTCAGCAGCTTGTCATCCTACAGAAAACCTCATCGCATCAGCAGCATT
AGAAAATGACAAAACAATTAAACTGTGGATGAGTAACCACTACCCAACTT
TCTTGTACAAAGTGGTGGTACCTCGAAGTTCCTATTCTCTACTTAGTATA
GGAACTTCCATCCTTGGAGCTCCTTCAGGAGGCGGTGCTACTGCTGGCGC
TGGTGGAGCCGGTGGACCTGCGGGGTTAATTTACCCATACGATGTTCCTG
ACTATGCGGGCTATCCCTATGACGTCCCGGACTATGCAGGATCCTATCCA
TATGACGTTCCAGATTACGCTTGA
MATKESRDAKAQLALSSSANQSKEVPENPNYALKCTLVGHTEAVSSVKFS
PNGEWLASSSADRLIIIWGAYDGKYEKTLYGHNLEISDVAWSSDSSRLVS
ASDDKTLKLWDVRSGKCLKTLKGHSNYVFCCNFNPPSNLIISGSFDETVK
IWEVKTGKCLKTLSAHSDPVSAVHFNCSGSLIVSGSYDGLCRIWDAASGQ
CLKTLVDDDNPPVSFVKFSPNGKYILTATLDNTLKLWDYSRGRCLKTYTG
HKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVV
ISAACHPTENLIASAALENDKTIKLWMSNHYPTFLYKVVVPRSSYSLLSI
GTSILGAPSGGGATAGAGGAGGPAGLIYPYDVPDYAGYPYDVPDYAGSYP
YDVPDYA*

Index