Stock Number Hs1503

Human Gene: CLVS2


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
CLVS2 clavesin 2 HGNC:23046 6q22.31 Cralbp 3L

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO02947 pGW-HA.attB ENST00000275162.9 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK37166208984892

Sequences

DNA sequence (1215 bp) Protein sequence (405 aa)
ATGACTCATTTGCAAGCCGGTCTCTCCCCTGAGACCCTGGAGAAAGCTCG
CCTGGAGCTCAATGAAAACCCAGACACGCTGCACCAGGACATCCAGGAGG
TGAGGGATATGGTCATCACCAGGCCGGACATTGGCTTTCTGCGCACGGAT
GATGCCTTCATCTTACGCTTCTTGCGGGCTAGGAAGTTTCATCACTTTGA
GGCCTTCCGCCTCCTGGCGCAGTACTTTGAGTACCGGCAGCAGAACCTGG
ACATGTTCAAAAGCTTTAAGGCCACCGACCCTGGCATCAAGCAGGCACTG
AAGGATGGCTTCCCTGGGGGCCTGGCCAATCTGGACCACTATGGCAGGAA
GATTCTAGTCCTTTTTGCTGCCAATTGGGATCAGAGCAGGTACACACTGG
TGGATATTTTGCGTGCCATCTTACTTTCTTTAGAAGCCATGATTGAAGAT
CCTGAGCTTCAAGTGAATGGGTTTGTTTTGATCATAGACTGGAGTAACTT
CACTTTCAAGCAAGCCTCTAAACTCACACCAAGTATGCTGCGATTAGCTA
TTGAAGGCCTGCAGGATAGTTTCCCAGCGCGATTTGGAGGAATTCATTTT
GTCAATCAACCATGGTATATCCATGCCCTGTACACCGTGATCCGGCCTTT
CCTGAAGGAGAAAACTCGGAAAAGGATATTTTTGCATGGTAACAACCTGA
ACAGTCTACACCAACTAATTCATCCTGAGATCCTGCCCTCTGAGTTTGGA
GGAATGCTGCCTCCTTATGACATGGGGACATGGGCAAGAACACTGCTAGA
CCATGAATATGACGATGACAGCGAGTACAATGTAGACTCCTACAGCATGC
CTGTGAAGGAAGTAGAGAAGGAACTCTCCCCAAAGTCCATGAAGAGATCT
CAATCAGTAGTGGATCCTACAGTACTAAAACGCATGGATAAAAATGAGGA
AGAAAACATGCAACCATTGCTTTCTCTGGACTTGCCAACTTTCTTGTACA
AAGTGGTGGTACCTCGAAGTTCCTATTCTCTACTTAGTATAGGAACTTCC
ATCCTTGGAGCTCCTTCAGGAGGCGGTGCTACTGCTGGCGCTGGTGGAGC
CGGTGGACCTGCGGGGTTAATTTACCCATACGATGTTCCTGACTATGCGG
GCTATCCCTATGACGTCCCGGACTATGCAGGATCCTATCCATATGACGTT
CCAGATTACGCTTGA
MTHLQAGLSPETLEKARLELNENPDTLHQDIQEVRDMVITRPDIGFLRTD
DAFILRFLRARKFHHFEAFRLLAQYFEYRQQNLDMFKSFKATDPGIKQAL
KDGFPGGLANLDHYGRKILVLFAANWDQSRYTLVDILRAILLSLEAMIED
PELQVNGFVLIIDWSNFTFKQASKLTPSMLRLAIEGLQDSFPARFGGIHF
VNQPWYIHALYTVIRPFLKEKTRKRIFLHGNNLNSLHQLIHPEILPSEFG
GMLPPYDMGTWARTLLDHEYDDDSEYNVDSYSMPVKEVEKELSPKSMKRS
QSVVDPTVLKRMDKNEEENMQPLLSLDLPTFLYKVVVPRSSYSLLSIGTS
ILGAPSGGGATAGAGGAGGPAGLIYPYDVPDYAGYPYDVPDYAGSYPYDV
PDYA*

Index