Stock Number Hs1502

Human Gene: KCTD12


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
KCTD12 potassium channel tetramerization domain containing 12 HGNC:14678 13q22.3 Ktl 3R

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO02932 pGW-HA.attB ENST00000377474.3 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK37166208884891

Sequences

DNA sequence (1209 bp) Protein sequence (403 aa)
ATGGCTCTGGCGGACAGCACACGTGGATTACCCAACGGGGGCGGCGGCGG
GGGCGGCAGTGGCTCCTCGTCGTCCTCCGCGGAGCCACCGCTCTTCCCCG
ACATCGTGGAGCTGAACGTGGGGGGCCAGGTGTACGTGACCCGGCGCTGC
ACGGTGGTGTCGGTGCCCGACTCGCTGCTCTGGCGCATGTTCACGCAGCA
GCAGCCGCAGGAGCTGGCCCGGGACAGCAAAGGCCGCTTCTTTCTGGACC
GGGACGGCTTCCTCTTCCGCTACATCCTGGATTACCTGCGGGACTTGCAG
CTCGTGCTGCCCGACTACTTCCCCGAGCGCAGCCGGCTGCAGCGCGAGGC
CGAGTACTTCGAGCTGCCAGAGCTCGTGCGCCGCCTCGGGGCGCCCCAGC
AGCCCGGCCCGGGGCCGCCGCCCTCGCGGCGCGGGGTGCACAAGGAGGGC
TCGCTGGGTGACGAGCTGCTGCCGCTTGGCTACTCGGAGCCCGAACAGCA
GGAGGGCGCCTCTGCCGGGGCGCCGTCGCCCACGCTGGAGCTGGCTAGCC
GCAGTCCGTCCGGGGGCGCGGCGGGCCCGCTGCTCACGCCGTCCCAGTCG
CTGGACGGCAGCCGGCGCTCGGGCTACATCACCATCGGCTACCGCGGCTC
CTACACCATCGGGCGGGACGCGCAGGCGGACGCCAAGTTCCGGCGAGTGG
CGCGCATCACCGTTTGCGGAAAGACGTCGCTGGCCAAGGAGGTGTTTGGG
GACACCCTGAACGAAAGCCGGGACCCCGACCGTCCCCCGGAGCGCTACAC
CTCGCGCTATTACCTCAAGTTCAACTTCCTGGAGCAGGCCTTCGACAAGC
TGTCCGAGTCGGGCTTCCACATGGTGGCGTGCAGCTCCACGGGCACCTGC
GCCTTTGCCAGCAGCACCGACCAGAGCGAGGACAAGATCTGGACCAGCTA
CACCGAGTACGTCTTCTGCAGGGAGTGCCCAACTTTCTTGTACAAAGTGG
TGGTACCTCGAAGTTCCTATTCTCTACTTAGTATAGGAACTTCCATCCTT
GGAGCTCCTTCAGGAGGCGGTGCTACTGCTGGCGCTGGTGGAGCCGGTGG
ACCTGCGGGGTTAATTTACCCATACGATGTTCCTGACTATGCGGGCTATC
CCTATGACGTCCCGGACTATGCAGGATCCTATCCATATGACGTTCCAGAT
TACGCTTGA
MALADSTRGLPNGGGGGGGSGSSSSSAEPPLFPDIVELNVGGQVYVTRRC
TVVSVPDSLLWRMFTQQQPQELARDSKGRFFLDRDGFLFRYILDYLRDLQ
LVLPDYFPERSRLQREAEYFELPELVRRLGAPQQPGPGPPPSRRGVHKEG
SLGDELLPLGYSEPEQQEGASAGAPSPTLELASRSPSGGAAGPLLTPSQS
LDGSRRSGYITIGYRGSYTIGRDAQADAKFRRVARITVCGKTSLAKEVFG
DTLNESRDPDRPPERYTSRYYLKFNFLEQAFDKLSESGFHMVACSSTGTC
AFASSTDQSEDKIWTSYTEYVFCRECPTFLYKVVVPRSSYSLLSIGTSIL
GAPSGGGATAGAGGAGGPAGLIYPYDVPDYAGYPYDVPDYAGSYPYDVPD
YA*

Index