Stock Number Hs1501

Human Gene: PITX2


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
PITX2 paired like homeodomain 2 HGNC:9005 4q25 Ptx1 3R

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO02926 pGW-HA.attB ENST00000306732.7 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK37166208784890

Sequences

DNA sequence (1206 bp) Protein sequence (402 aa)
ATGAACTGCATGAAAGGCCCGCTTCACTTGGAGCACCGAGCAGCGGGGAC
CAAGCTGTCGGCCGTCTCCTCATCTTCCTGTCACCATCCCCAGCCGTTAG
CCATGGCTTCGGTTCTGGCTCCCGGTCAGCCCCGGTCGCTGGACTCCTCC
AAGCACAGGCTGGAGGTGCACACCATCTCCGACACCTCCAGCCCGGAGGC
CGCAGAGAAAGATAAAAGCCAGCAGGGGAAGAATGAGGACGTGGGCGCCG
AGGACCCGTCTAAGAAGAAGCGGCAAAGGCGGCAGCGGACTCACTTTACC
AGCCAGCAGCTCCAGGAGCTGGAGGCCACTTTCCAGAGGAACCGCTACCC
GGACATGTCCACACGCGAAGAAATCGCTGTGTGGACCAACCTTACGGAAG
CCCGAGTCCGGGTTTGGTTCAAGAATCGTCGGGCCAAATGGAGAAAGAGG
GAGCGCAACCAGCAGGCCGAGCTATGCAAGAATGGCTTCGGGCCGCAGTT
CAATGGGCTCATGCAGCCCTACGACGACATGTACCCAGGCTATTCCTACA
ACAACTGGGCCGCCAAGGGCCTTACATCCGCCTCCCTATCCACCAAGAGC
TTCCCCTTCTTCAACTCTATGAACGTCAACCCCCTGTCATCACAGAGCAT
GTTTTCCCCACCCAACTCTATCTCGTCCATGAGCATGTCGTCCAGCATGG
TGCCCTCAGCAGTGACAGGCGTCCCGGGCTCCAGTCTCAACAGCCTGAAT
AACTTGAACAACCTGAGTAGCCCGTCGCTGAATTCCGCGGTGCCGACGCC
TGCCTGTCCTTACGCGCCGCCGACTCCTCCGTATGTTTATAGGGACACGT
GTAACTCGAGCCTGGCCAGCCTGAGACTGAAAGCAAAGCAGCACTCCAGC
TTCGGCTACGCCAGCGTGCAGAACCCGGCCTCCAACCTGAGTGCTTGCCA
GTATGCAGTGGACCGGCCCGTGTGCCCAACTTTCTTGTACAAAGTGGTGG
TACCTCGAAGTTCCTATTCTCTACTTAGTATAGGAACTTCCATCCTTGGA
GCTCCTTCAGGAGGCGGTGCTACTGCTGGCGCTGGTGGAGCCGGTGGACC
TGCGGGGTTAATTTACCCATACGATGTTCCTGACTATGCGGGCTATCCCT
ATGACGTCCCGGACTATGCAGGATCCTATCCATATGACGTTCCAGATTAC
GCTTGA
MNCMKGPLHLEHRAAGTKLSAVSSSSCHHPQPLAMASVLAPGQPRSLDSS
KHRLEVHTISDTSSPEAAEKDKSQQGKNEDVGAEDPSKKKRQRRQRTHFT
SQQLQELEATFQRNRYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKR
ERNQQAELCKNGFGPQFNGLMQPYDDMYPGYSYNNWAAKGLTSASLSTKS
FPFFNSMNVNPLSSQSMFSPPNSISSMSMSSSMVPSAVTGVPGSSLNSLN
NLNNLSSPSLNSAVPTPACPYAPPTPPYVYRDTCNSSLASLRLKAKQHSS
FGYASVQNPASNLSACQYAVDRPVCPTFLYKVVVPRSSYSLLSIGTSILG
APSGGGATAGAGGAGGPAGLIYPYDVPDYAGYPYDVPDYAGSYPYDVPDY
A*

Index