Stock Number Hs1500

Human Gene: TMEM30A


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
TMEM30A transmembrane protein 30A HGNC:16667 6q14.1 CDC50 X

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO02833 pGW-HA.attB ENST00000475111.6 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK37166208684889

Sequences

DNA sequence (1209 bp) Protein sequence (403 aa)
ATGGCGATGAACTATAACGCGAAGGATGAAGTGGACGGTGGGCCCCCGTG
TGCTCCGGGGGGCACCGCGAAGACTCGGAGACCGGATAACACGGCCTTCA
AACAGCAACGGCTGCCAGCTTGGCAGCCCATCCTTACGGCTGGCACGGTG
CTACCTATTTTCTTCATCATCGGTCTCATCTTCATTCCCATCGGCATTGG
CATTTTTGTCACCTCCAACAACATCCGCGAGATCGAGGGCAACGTGTTTA
TGTATTATGGACTGTCTAATTTCTATCAAAACCATCGTCGTTACGTGAAA
TCTCGAGATGATAGTCAACTAAATGGAGATTCTAGTGCTTTGCTTAATCC
CAGTAAGGAATGTGAACCTTATCGAAGAAATGAAGACAAACCAATTGCTC
CTTGTGGAGCTATTGCCAACAGCATGTTTAATGATACATTAGAATTGTTT
CTCATTGGCAATGATTCTTATCCTATACCTATCGCTTTGAAAAAGAAAGG
TATTGCTTGGTGGACAGATAAAAATGTGAAATTCAGAAATCCCCCTGGAG
GAGACAACCTGGAAGAACGATTTAAAGGTACAACAAAGCCTGTGAACTGG
CTTAAACCAGTTTACATGCTGGATTCTGACCCAGATAATAATGGATTCAT
AAATGAGGATTTTATTGTTTGGATGCGTACTGCAGCATTACCTACTTTTC
GCAAGTTGTATCGTCTTATAGAAAGGAAAAGTGATTTACATCCAACATTA
CCAGCTGGCCGATACTCTTTGAATGTCACATACAATTACCCTGTACATTA
TTTTGATGGACGAAAACGGATGATCTTGAGCACTATTTCATGGATGGGAG
GAAAAAATCCATTTTTGGGGATTGCTTACATCGCTGTTGGATCCATCTCC
TTCCTTCTGGGAGTTGTACTGCTAGTAATTAATCATAAATATAGAAACAG
TAGTAATACAGCTGACATTACCATTTACCCAACTTTCTTGTACAAAGTGG
TGGTACCTCGAAGTTCCTATTCTCTACTTAGTATAGGAACTTCCATCCTT
GGAGCTCCTTCAGGAGGCGGTGCTACTGCTGGCGCTGGTGGAGCCGGTGG
ACCTGCGGGGTTAATTTACCCATACGATGTTCCTGACTATGCGGGCTATC
CCTATGACGTCCCGGACTATGCAGGATCCTATCCATATGACGTTCCAGAT
TACGCTTGA
MAMNYNAKDEVDGGPPCAPGGTAKTRRPDNTAFKQQRLPAWQPILTAGTV
LPIFFIIGLIFIPIGIGIFVTSNNIREIEGNVFMYYGLSNFYQNHRRYVK
SRDDSQLNGDSSALLNPSKECEPYRRNEDKPIAPCGAIANSMFNDTLELF
LIGNDSYPIPIALKKKGIAWWTDKNVKFRNPPGGDNLEERFKGTTKPVNW
LKPVYMLDSDPDNNGFINEDFIVWMRTAALPTFRKLYRLIERKSDLHPTL
PAGRYSLNVTYNYPVHYFDGRKRMILSTISWMGGKNPFLGIAYIAVGSIS
FLLGVVLLVINHKYRNSSNTADITIYPTFLYKVVVPRSSYSLLSIGTSIL
GAPSGGGATAGAGGAGGPAGLIYPYDVPDYAGYPYDVPDYAGSYPYDVPD
YA*

Index