Stock Number Hs1499

Human Gene: ADORA2B


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
ADORA2B adenosine A2b receptor HGNC:264 17p12 AdoR 3R

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO02972 pGW-HA.attB ENST00000304222.2 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK37166208584888

Sequences

DNA sequence (1230 bp) Protein sequence (410 aa)
ATGCTGCTGGAGACACAGGACGCGCTGTACGTGGCGCTGGAGCTGGTCAT
CGCCGCGCTTTCGGTGGCGGGCAACGTGCTGGTGTGCGCCGCGGTGGGCA
CGGCGAACACTCTGCAGACGCCCACCAACTACTTCCTGGTGTCCCTGGCT
GCGGCCGACGTGGCCGTGGGGCTCTTCGCCATCCCCTTTGCCATCACCAT
CAGCCTGGGCTTCTGCACTGACTTCTACGGCTGCCTCTTCCTCGCCTGCT
TCGTGCTGGTGCTCACGCAGAGCTCCATCTTCAGCCTTCTGGCCGTGGCA
GTCGACAGATACCTGGCCATCTGTGTCCCGCTCAGGTATAAAAGTTTGGT
CACGGGGACCCGAGCAAGAGGGGTCATTGCTGTCCTCTGGGTCCTTGCCT
TTGGCATCGGATTGACTCCATTCCTGGGGTGGAACAGTAAAGACAGTGCC
ACCAACAACTGCACAGAACCCTGGGATGGAACCACGAATGAAAGCTGCTG
CCTTGTGAAGTGTCTCTTTGAGAATGTGGTCCCCATGAGCTACATGGTAT
ATTTCAATTTCTTTGGGTGTGTTCTGCCCCCACTGCTTATAATGCTGGTG
ATCTACATTAAGATCTTCCTGGTGGCCTGCAGGCAGCTTCAGCGCACTGA
GCTGATGGACCACTCGAGGACCACCCTCCAGCGGGAGATCCATGCAGCCA
AGTCACTGGCCATGATTGTGGGGATTTTTGCCCTGTGCTGGTTACCTGTG
CATGCTGTTAACTGTGTCACTCTTTTCCAGCCAGCTCAGGGTAAAAATAA
GCCCAAGTGGGCAATGAATATGGCCATTCTTCTGTCACATGCCAATTCAG
TTGTCAATCCCATTGTCTATGCTTACCGGAACCGAGACTTCCGCTACACT
TTTCACAAAATTATCTCCAGGTATCTTCTCTGCCAAGCAGATGTCAAGAG
TGGGAATGGTCAGGCTGGGGTACAGCCTGCTCTCGGTGTGGGCCTATGCC
CAACTTTCTTGTACAAAGTGGTGGTACCTCGAAGTTCCTATTCTCTACTT
AGTATAGGAACTTCCATCCTTGGAGCTCCTTCAGGAGGCGGTGCTACTGC
TGGCGCTGGTGGAGCCGGTGGACCTGCGGGGTTAATTTACCCATACGATG
TTCCTGACTATGCGGGCTATCCCTATGACGTCCCGGACTATGCAGGATCC
TATCCATATGACGTTCCAGATTACGCTTGA
MLLETQDALYVALELVIAALSVAGNVLVCAAVGTANTLQTPTNYFLVSLA
AADVAVGLFAIPFAITISLGFCTDFYGCLFLACFVLVLTQSSIFSLLAVA
VDRYLAICVPLRYKSLVTGTRARGVIAVLWVLAFGIGLTPFLGWNSKDSA
TNNCTEPWDGTTNESCCLVKCLFENVVPMSYMVYFNFFGCVLPPLLIMLV
IYIKIFLVACRQLQRTELMDHSRTTLQREIHAAKSLAMIVGIFALCWLPV
HAVNCVTLFQPAQGKNKPKWAMNMAILLSHANSVVNPIVYAYRNRDFRYT
FHKIISRYLLCQADVKSGNGQAGVQPALGVGLCPTFLYKVVVPRSSYSLL
SIGTSILGAPSGGGATAGAGGAGGPAGLIYPYDVPDYAGYPYDVPDYAGS
YPYDVPDYA*

Index