Stock Number Hs1498

Human Gene: MIER1


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
MIER1 MIER1 transcriptional regulator HGNC:29657 1p31.3 CG1620 2R

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03245 pGW-HA.attB ENST00000355977.10 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK33166208484887

Sequences

DNA sequence (1344 bp) Protein sequence (448 aa)
ATGCCAATTCATGAACTTCTCAGCCTTTATGGTTATGGTAGTACTGTTCG
ACTACCTGAAGAAGATGAGGAAGAGGAAGAAGAGGAAGAAGAAGGTGAAG
ATGATGAAGATGCTGATAATGATGACAACAGTGGCTGTAGTGGGGAAAAT
AAAGAGGAGAATATAAAGGATTCATCAGGTCAGGAGGATGAAACTCAGTC
TTCCAATGATGATCCATCACAATCTGTTGCTTCTCAAGATGCCCAGGAAA
TAATCCGCCCACGTCGATGTAAATATTTTGATACAAATAGTGAAGTAGAA
GAAGAATCTGAAGAAGATGAAGATTATATTCCATCAGAAGACTGGAAAAA
GGAGATTATGGTGGGCTCCATGTTTCAAGCAGAAATTCCAGTTGGCATTT
GTAGATACAAAGAAAATGAAAAAGTATATGAAAATGATGATCAGCTCCTG
TGGGACCCTGAGTACTTACCAGAAGATAAAGTGATTATATTTCTTAAAGA
TGCATCTAGAAGAACAGGTGATGAGAAGGGTGTAGAAGCAATTCCTGAAG
GATCTCACATAAAAGACAATGAACAGGCTTTATATGAATTGGTTAAATGC
AATTTTGATACAGAAGAAGCATTGAGAAGATTAAGATTTAATGTAAAAGC
AGCTAGAGAGGAATTATCTGTTTGGACAGAGGAAGAGTGTAGAAATTTTG
AACAAGGGCTGAAGGCCTATGGAAAGGATTTTCATTTGATTCAGGCTAAT
AAAGTCCGAACAAGGTCAGTTGGTGAATGTGTAGCATTCTATTACATGTG
GAAAAAATCTGAACGTTATGATTTCTTTGCTCAGCAAACACGATTTGGAA
AGAAGAAATATAATCTTCATCCTGGTGTAACGGATTACATGGATCGTCTT
CTAGACGAAAGTGAAAGTGCTGCATCTAGTCGAGCACCATCCCCTCCCCC
AACTGCATCAAACAGTAGTAACAGCCAGTCTGAGAAAGAAGATGGCACTG
TAAGCACTGCTAATCAAAATGGAGTGTCATCTAATGGACCAGGCATACTC
CAAATGCTTCTTCCAGTTCATTTTTCAGCCATCAGTTCAAGAGCCAATGC
CTTTTTAAAATTGCCAACTTTCTTGTACAAAGTGGTGGTACCTCGAAGTT
CCTATTCTCTACTTAGTATAGGAACTTCCATCCTTGGAGCTCCTTCAGGA
GGCGGTGCTACTGCTGGCGCTGGTGGAGCCGGTGGACCTGCGGGGTTAAT
TTACCCATACGATGTTCCTGACTATGCGGGCTATCCCTATGACGTCCCGG
ACTATGCAGGATCCTATCCATATGACGTTCCAGATTACGCTTGA
MPIHELLSLYGYGSTVRLPEEDEEEEEEEEEGEDDEDADNDDNSGCSGEN
KEENIKDSSGQEDETQSSNDDPSQSVASQDAQEIIRPRRCKYFDTNSEVE
EESEEDEDYIPSEDWKKEIMVGSMFQAEIPVGICRYKENEKVYENDDQLL
WDPEYLPEDKVIIFLKDASRRTGDEKGVEAIPEGSHIKDNEQALYELVKC
NFDTEEALRRLRFNVKAAREELSVWTEEECRNFEQGLKAYGKDFHLIQAN
KVRTRSVGECVAFYYMWKKSERYDFFAQQTRFGKKKYNLHPGVTDYMDRL
LDESESAASSRAPSPPPTASNSSNSQSEKEDGTVSTANQNGVSSNGPGIL
QMLLPVHFSAISSRANAFLKLPTFLYKVVVPRSSYSLLSIGTSILGAPSG
GGATAGAGGAGGPAGLIYPYDVPDYAGYPYDVPDYAGSYPYDVPDYA*

Index