Stock Number Hs1497

Human Gene: PLCXD1


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
PLCXD1 phosphatidylinositol specific phospholipase C X domain containing 1 HGNC:23148 Xp22.33 and Yp11.32 CG10747 2L

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO02813 pGW-HA.attB ENST00000445062.6_PAR_Y Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK33166208384886

Sequences

DNA sequence (1203 bp) Protein sequence (401 aa)
ATGGGCGGGCAGGTGAGCGCTTCCAACAGCTTCTCGAGGCTGCACTGCAG
AAATGCCAACGAGGACTGGATGTCGGCACTGTGTCCCCGGCTCTGGGATG
TGCCCCTCCACCACCTCTCCATCCCAGGGAGCCACGACACGATGACGTAC
TGCCTGAACAAGAAGTCCCCCATTTCGCACGAGGAGTCCCGGCTGCTGCA
GCTGCTGAACAAGGCCTTGCCCTGCATCACGCGCCCTGTCGTGCTGAAAT
GGTCCGTCACCCAGGCACTGGACGTCACAGAGCAGCTGGATGCCGGGGTG
CGGTACCTGGACCTGCGGATAGCCCACATGCTGGAGGGCTCGGAGAAGAA
CCTGCACTTTGTCCATATGGTGTACACAACGGCGCTGGTGGAGGACACAC
TCACGGAAATCTCGGAGTGGCTGGAGCGGCATCCACGCGAGGTGGTCATC
CTGGCCTGCAGAAACTTCGAGGGGCTGAGCGAGGACCTGCACGAGTACCT
GGTCGCCTGTATCAAGAACATCTTCGGGGACATGCTGTGTCCTCGTGGGG
AGGTGCCGACACTGCGGCAGCTGTGGTCCCGGGGCCAACAGGTCATCGTC
TCCTATGAAGACGAGAGCTCCTTGCGCCGGCACCACGAGCTGTGGCCAGG
AGTCCCCTACTGGTGGGGAAACAGGGTGAAGACCGAGGCCCTCATCCGAT
ACCTGGAGACCATGAAGAGCTGCGGCCGCCCAGGAGGGTTGTTCGTGGCC
GGCATCAACCTCACGGAGAACCTGCAGTACGTTCTGGCGCACCCGTCCGA
GTCCCTGGAGAAGATGACGCTGCCCAACCTTCCGCGGCTGAGCGCGTGGG
TCCGAGAGCAGTGCCCGGGGCCGGGTTCACGGTGCACCAACATCATCGCG
GGGGACTTCATCGGCGCAGACGGCTTCGTCAGTGACGTCATCGCGCTCAA
TCAGAAGCTGCTGTGGTGCTACCCAACTTTCTTGTACAAAGTGGTGGTAC
CTCGAAGTTCCTATTCTCTACTTAGTATAGGAACTTCCATCCTTGGAGCT
CCTTCAGGAGGCGGTGCTACTGCTGGCGCTGGTGGAGCCGGTGGACCTGC
GGGGTTAATTTACCCATACGATGTTCCTGACTATGCGGGCTATCCCTATG
ACGTCCCGGACTATGCAGGATCCTATCCATATGACGTTCCAGATTACGCT
TGA
MGGQVSASNSFSRLHCRNANEDWMSALCPRLWDVPLHHLSIPGSHDTMTY
CLNKKSPISHEESRLLQLLNKALPCITRPVVLKWSVTQALDVTEQLDAGV
RYLDLRIAHMLEGSEKNLHFVHMVYTTALVEDTLTEISEWLERHPREVVI
LACRNFEGLSEDLHEYLVACIKNIFGDMLCPRGEVPTLRQLWSRGQQVIV
SYEDESSLRRHHELWPGVPYWWGNRVKTEALIRYLETMKSCGRPGGLFVA
GINLTENLQYVLAHPSESLEKMTLPNLPRLSAWVREQCPGPGSRCTNIIA
GDFIGADGFVSDVIALNQKLLWCYPTFLYKVVVPRSSYSLLSIGTSILGA
PSGGGATAGAGGAGGPAGLIYPYDVPDYAGYPYDVPDYAGSYPYDVPDYA
*

Index