Stock Number Hs1493

Human Gene: CA3


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
CA3 carbonic anhydrase 3 HGNC:1374 8q21.2 CAH1 2L

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO02314 pGW-HA.attB ENST00000520921.1 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK33166207984883

Sequences

DNA sequence (1014 bp) Protein sequence (338 aa)
ATGGCCAAGGAGTGGGGCTACGCCAGTCACAACGGTCCTGACCACTGGCA
TGAACTTTTCCCAAATGCCAAGGGGGAAAACCAGTCGCCCATTGAGCTGC
ATACTAAAGACATCAGGCATGACCCTTCTCTGCAGCCATGGTCTGTGTCT
TATGATGGTGGCTCTGCCAAGACCATCCTGAATAATGGGAAGACCTGCCG
AGTTGTATTTGATGATACTTATGATAGGTCAATGCTGAGAGGGGGTCCTC
TCCCTGGACCCTACCGACTTCGCCAGTTTCATCTTCACTGGGGCTCTTCG
GATGATCATGGCTCTGAGCACACCGTGGATGGAGTCAAGTATGCAGCGGA
GCTTCATTTGGTTCACTGGAACCCGAAGTATAACACTTTTAAAGAAGCCC
TGAAGCAGCGCGATGGGATCGCTGTGATTGGCATTTTTCTGAAGATAGGA
CATGAGAATGGCGAGTTCCAGATTTTCCTTGATGCATTGGACAAGATTAA
GACAAAGGGCAAGGAGGCGCCCTTCACAAAGTTTGACCCATCCTGCCTGT
TCCCGGCATGCCGGGACTACTGGACCTACCAGGGCTCATTCACCACGCCG
CCCTGCGAGGAATGCATTGTGTGGCTGCTGCTGAAGGAGCCCATGACCGT
GAGCTCTGACCAGATGGCCAAGCTGCGGAGCCTCCTCTCCAGTGCTGAGA
ACGAGCCCCCAGTGCCTCTTGTGAGCAACTGGCGACCTCCACAGCCTATC
AATAACAGGGTGGTGAGAGCTTCCTTCAAATGCCCAACTTTCTTGTACAA
AGTGGTGGTACCTCGAAGTTCCTATTCTCTACTTAGTATAGGAACTTCCA
TCCTTGGAGCTCCTTCAGGAGGCGGTGCTACTGCTGGCGCTGGTGGAGCC
GGTGGACCTGCGGGGTTAATTTACCCATACGATGTTCCTGACTATGCGGG
CTATCCCTATGACGTCCCGGACTATGCAGGATCCTATCCATATGACGTTC
CAGATTACGCTTGA
MAKEWGYASHNGPDHWHELFPNAKGENQSPIELHTKDIRHDPSLQPWSVS
YDGGSAKTILNNGKTCRVVFDDTYDRSMLRGGPLPGPYRLRQFHLHWGSS
DDHGSEHTVDGVKYAAELHLVHWNPKYNTFKEALKQRDGIAVIGIFLKIG
HENGEFQIFLDALDKIKTKGKEAPFTKFDPSCLFPACRDYWTYQGSFTTP
PCEECIVWLLLKEPMTVSSDQMAKLRSLLSSAENEPPVPLVSNWRPPQPI
NNRVVRASFKCPTFLYKVVVPRSSYSLLSIGTSILGAPSGGGATAGAGGA
GGPAGLIYPYDVPDYAGYPYDVPDYAGSYPYDVPDYA*

Index