Stock Number Hs1492

Human Gene: CACNG7


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
CACNG7 calcium voltage-gated channel auxiliary subunit gamma 7 HGNC:13626 19q13.42 stg1 X

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO02275 pGW-HA.attB ENST00000222212.6 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK37166207884882

Sequences

DNA sequence (1059 bp) Protein sequence (353 aa)
ATGAGTCACTGCAGCAGCCGCGCCCTGACCCTGCTGAGCAGCGTGTTTGG
TGCGTGTGGCCTGCTCCTGGTAGGCATCGCGGTCAGCACTGACTACTGGC
TGTACATGGAAGAAGGCACAGTGCTACCGCAGAACCAGACCACCGAGGTC
AAGATGGCCCTGCACGCCGGCCTCTGGCGAGTCTGCTTCTTTGCAGGTCG
GGAGAAAGGTCGCTGTGTGGCCTCAGAATATTTTCTTGAACCGGAGATCA
ATTTGGTGACGGAAAACACGGAGAATATTCTGAAGACAGTGCGCACGGCC
ACCCCCTTCCCCATGGTCAGCCTCTTCCTCGTGTTCACGGCCTTCGTCAT
CAGCAACATCGGCCACATCCGCCCGCAGAGGACCATTCTGGCTTTTGTCT
CTGGCATCTTCTTCATACTATCGGGCCTCTCCTTGGTGGTGGGCTTGGTT
CTTTACATCTCCAGCATCAACGACGAGGTCATGAACAGGCCCAGCAGCTC
TGAGCAGTATTTTCATTATCGCTACGGGTGGTCTTTTGCCTTCGCCGCTT
CCTCCTTCCTACTCAAAGAGGGGGCCGGCGTGATGTCCGTGTACCTGTTC
ACCAAGCGCTACGCGGAGGAGGAGATGTACCGTCCACACCCGGCCTTCTA
CCGCCCGCGTCTCAGCGACTGCTCCGACTACTCGGGCCAGTTCCTGCAGC
CCGAGGCGTGGCGCCGCGGCCGGAGCCCCTCCGACATCTCCAGCGACGTG
TCCATCCAAATGACGCAGAACTACCCTCCCGCCATCAAGTACCCGGACCA
CCTGCACATCTCCACCTCGCCCTGCTTGCCAACTTTCTTGTACAAAGTGG
TGGTACCTCGAAGTTCCTATTCTCTACTTAGTATAGGAACTTCCATCCTT
GGAGCTCCTTCAGGAGGCGGTGCTACTGCTGGCGCTGGTGGAGCCGGTGG
ACCTGCGGGGTTAATTTACCCATACGATGTTCCTGACTATGCGGGCTATC
CCTATGACGTCCCGGACTATGCAGGATCCTATCCATATGACGTTCCAGAT
TACGCTTGA
MSHCSSRALTLLSSVFGACGLLLVGIAVSTDYWLYMEEGTVLPQNQTTEV
KMALHAGLWRVCFFAGREKGRCVASEYFLEPEINLVTENTENILKTVRTA
TPFPMVSLFLVFTAFVISNIGHIRPQRTILAFVSGIFFILSGLSLVVGLV
LYISSINDEVMNRPSSSEQYFHYRYGWSFAFAASSFLLKEGAGVMSVYLF
TKRYAEEEMYRPHPAFYRPRLSDCSDYSGQFLQPEAWRRGRSPSDISSDV
SIQMTQNYPPAIKYPDHLHISTSPCLPTFLYKVVVPRSSYSLLSIGTSIL
GAPSGGGATAGAGGAGGPAGLIYPYDVPDYAGYPYDVPDYAGSYPYDVPD
YA*

Index