Stock Number Hs1491

Human Gene: AES


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
AES amino-terminal enhancer of split HGNC:307 19p13.3 gro 3R

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO02231 pGW-HA.attB ENST00000221561.12 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK37166207784881 FBti0207818

Sequences

DNA sequence (1026 bp) Protein sequence (342 aa)
ATGTGTCACAAGAATGGCTTCCCTCAGGAAGGCGGCATTACCGCTGCCTT
TCTGCAGAAAAGGAAACTAAGGCTCAGCAAGAACCACCGCCCAGCCAGAG
CCAAGGTCACAGAGCACGTCCGTGGCACGCGTCCAGGTCGTGCCACAGCA
GGGCCGGCGGCTTCGACGCGGGCAGCCGGGTCCCTTTTCTTTGACAGATG
GGGAAACCGAGGCCCGGCCGGCTGCCGGGGCTCCTCGCACCTACCCCAGC
AACTCAAATTCACCACCTCGGACTCCTGCGACCGCATCAAAGACGAATTT
CAGCTACTGCAAGCTCAGTACCACAGCCTCAAGCTCGAATGTGACAAGTT
GGCCAGTGAGAAGTCAGAGATGCAGCGTCACTATGTGATGTACTACGAGA
TGTCCTACGGCTTGAACATCGAGATGCACAAACAGGCTGAGATCGTCAAA
AGGCTGAACGGGATTTGTGCCCAGGTCCTGCCCTACCTCTCCCAAGAGCA
CCAGCAGCAGGTCTTGGGAGCCATTGAGAGGGCCAAGCAGGTCACCGCTC
CCGAGCTGAACTCTATCATCCGACAGCAGCTCCAAGCCCACCAGCTGTCC
CAGCTGCAGGCCCTGGCCCTGCCCTTGACCCCACTACCCGTGGGGCTGCA
GCCGCCTTCGCTGCCGGCGGTCAGCGCAGGCACCGGCCTCCTCTCGCTGT
CCGCGCTGGGTTCCCAGGCCCACCTCTCCAAGGAAGACAAGAACGGGCAC
GATGGTGACACCCACCAGGAGGATGATGGCGAGAAGTCGGATTTGCCAAC
TTTCTTGTACAAAGTGGTGGTACCTCGAAGTTCCTATTCTCTACTTAGTA
TAGGAACTTCCATCCTTGGAGCTCCTTCAGGAGGCGGTGCTACTGCTGGC
GCTGGTGGAGCCGGTGGACCTGCGGGGTTAATTTACCCATACGATGTTCC
TGACTATGCGGGCTATCCCTATGACGTCCCGGACTATGCAGGATCCTATC
CATATGACGTTCCAGATTACGCTTGA
MCHKNGFPQEGGITAAFLQKRKLRLSKNHRPARAKVTEHVRGTRPGRATA
GPAASTRAAGSLFFDRWGNRGPAGCRGSSHLPQQLKFTTSDSCDRIKDEF
QLLQAQYHSLKLECDKLASEKSEMQRHYVMYYEMSYGLNIEMHKQAEIVK
RLNGICAQVLPYLSQEHQQQVLGAIERAKQVTAPELNSIIRQQLQAHQLS
QLQALALPLTPLPVGLQPPSLPAVSAGTGLLSLSALGSQAHLSKEDKNGH
DGDTHQEDDGEKSDLPTFLYKVVVPRSSYSLLSIGTSILGAPSGGGATAG
AGGAGGPAGLIYPYDVPDYAGYPYDVPDYAGSYPYDVPDYA*

Index