Stock Number Hs1490

Human Gene: CTDSP2


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
CTDSP2 CTD small phosphatase 2 HGNC:17077 12q14.1 CG5830 3L

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO02356 pGW-HA.attB ENST00000549039.5 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK37166207684880

Sequences

DNA sequence (1047 bp) Protein sequence (349 aa)
ATGGAACACGGCTCCATCATCACCCAGGCGCGGAGGGAAGACGCCCTGGT
GCTCACCAAGCAAGGCCTGGTCTCCAAGTCCTCTCCTAAGAAGCCTCGTG
GACGTAACATCTTCAAGGCCCTTTTCTGCTGTTTTCGCGCCCAGCATGTT
GGCCAGTCAAGTTCCTCCACTGAGCTCGCTGCGTATAAGGAGGAAGCAAA
CACCATTGCTAAGTCGGATCTGCTCCAGTGTCTCCAGTACCAGTTCTACC
AGATCCCAGGGACCTGCCTGCTCCCAGAGGTGACAGAGGAAGATCAAGGA
AGGATCTGTGTGGTCATTGACCTCGATGAAACCCTTGTGCATAGCTCCTT
TAAGCCAATCAACAATGCTGACTTCATAGTGCCTATAGAGATTGAGGGGA
CCACTCACCAGGTGTATGTGCTCAAGAGGCCTTATGTGGATGAGTTCCTG
AGACGCATGGGGGAACTCTTTGAATGTGTTCTCTTCACTGCCAGCCTGGC
CAAGTATGCCGACCCTGTGACAGACCTGCTGGACCGGTGTGGGGTGTTCC
GGGCCCGCCTATTCCGTGAGTCTTGCGTGTTCCACCAGGGCTGCTACGTC
AAGGACCTCAGCCGCCTGGGGAGGGACCTGAGAAAGACCCTCATCCTGGA
CAACTCGCCTGCTTCTTACATATTCCACCCCGAGAATGCAGTGCCTGTGC
AGTCCTGGTTTGATGACATGGCAGACACTGAGTTGCTGAACCTGATCCCA
ATCTTTGAGGAGCTGAGCGGAGCAGAGGACGTCTACACCAGCCTTGGGCA
GCTGCGGGCCCCTTACCCAACTTTCTTGTACAAAGTGGTGGTACCTCGAA
GTTCCTATTCTCTACTTAGTATAGGAACTTCCATCCTTGGAGCTCCTTCA
GGAGGCGGTGCTACTGCTGGCGCTGGTGGAGCCGGTGGACCTGCGGGGTT
AATTTACCCATACGATGTTCCTGACTATGCGGGCTATCCCTATGACGTCC
CGGACTATGCAGGATCCTATCCATATGACGTTCCAGATTACGCTTGA
MEHGSIITQARREDALVLTKQGLVSKSSPKKPRGRNIFKALFCCFRAQHV
GQSSSSTELAAYKEEANTIAKSDLLQCLQYQFYQIPGTCLLPEVTEEDQG
RICVVIDLDETLVHSSFKPINNADFIVPIEIEGTTHQVYVLKRPYVDEFL
RRMGELFECVLFTASLAKYADPVTDLLDRCGVFRARLFRESCVFHQGCYV
KDLSRLGRDLRKTLILDNSPASYIFHPENAVPVQSWFDDMADTELLNLIP
IFEELSGAEDVYTSLGQLRAPYPTFLYKVVVPRSSYSLLSIGTSILGAPS
GGGATAGAGGAGGPAGLIYPYDVPDYAGYPYDVPDYAGSYPYDVPDYA*

Index