Stock Number Hs1489

Human Gene: RPA4


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
RPA4 replication protein A4 HGNC:30305 Xq21.33 RPA2 2L

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO02319 pGW-HA.attB ENST00000373040.4 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK33166207584879

Sequences

DNA sequence (1017 bp) Protein sequence (339 aa)
ATGAGTAAGAGTGGGTTTGGGAGCTATGGCAGCATTTCTGCTGCTGATGG
AGCGAGTGGAGGCAGTGACCAACTGTGTGAGAGAGATGCAACTCCTGCTA
TTAAGACCCAAAGACCTAAGGTCCGAATTCAGGACGTTGTACCGTGTAAT
GTGAACCAGCTTCTCAGCTCTACTGTGTTTGACCCTGTGTTCAAGGTTAG
GGGAATTATAGTTTCCCAGGTCTCCATCGTGGGGGTAATCAGAGGGGCAG
AGAAGGCTTCAAATCACATTTGTTACAAAATTGATGATATGACCGCGAAA
CCAATCGAGGCCCGACAGTGGTTTGGTAGAGAGAAAGTCAAGCAGGTGAC
TCCATTGTCAGTCGGAGTATATGTCAAAGTGTTTGGTATCCTCAAATGTC
CCACGGGAACAAAGAGCCTTGAGGTATTGAAAATTCATGTCCTAGAGGAC
ATGAACGAGTTCACCGTGCATATTCTGGAAACGGTCAATGCACACATGAT
GCTGGATAAAGCCCGTCGTGATACCACTGTAGAAAGTGTGCCTGTGTCTC
CATCAGAAGTGAATGATGCTGGGGATAACGATGAGAGTCACCGCAATTTC
ATCCAGGACGAAGTGCTGCGTTTGATTCATGAGTGTCCTCATCAGGAAGG
GAAGAGCATCCATGAGCTCCGGGCTCAGCTCTGCGACCTTAGCGTCAAGG
CCATCAAGGAAGCGATTGATTATCTGACCGTTGAGGGCCACATCTATCCC
ACTGTGGATCGGGAGCATTTTAAGTCTGCTGATTGCCCAACTTTCTTGTA
CAAAGTGGTGGTACCTCGAAGTTCCTATTCTCTACTTAGTATAGGAACTT
CCATCCTTGGAGCTCCTTCAGGAGGCGGTGCTACTGCTGGCGCTGGTGGA
GCCGGTGGACCTGCGGGGTTAATTTACCCATACGATGTTCCTGACTATGC
GGGCTATCCCTATGACGTCCCGGACTATGCAGGATCCTATCCATATGACG
TTCCAGATTACGCTTGA
MSKSGFGSYGSISAADGASGGSDQLCERDATPAIKTQRPKVRIQDVVPCN
VNQLLSSTVFDPVFKVRGIIVSQVSIVGVIRGAEKASNHICYKIDDMTAK
PIEARQWFGREKVKQVTPLSVGVYVKVFGILKCPTGTKSLEVLKIHVLED
MNEFTVHILETVNAHMMLDKARRDTTVESVPVSPSEVNDAGDNDESHRNF
IQDEVLRLIHECPHQEGKSIHELRAQLCDLSVKAIKEAIDYLTVEGHIYP
TVDREHFKSADCPTFLYKVVVPRSSYSLLSIGTSILGAPSGGGATAGAGG
AGGPAGLIYPYDVPDYAGYPYDVPDYAGSYPYDVPDYA*

Index