Stock Number Hs1488

Human Gene: CHCHD10


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
CHCHD10 coiled-coil-helix-coiled-coil-helix domain containing 10 HGNC:15559 22q11.23 Chchd2 X

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO01232 pUASgHA.attB ENST00000484558.2 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK37166207484878

Sequences

DNA sequence (615 bp) Protein sequence (205 aa)
ATGCCTCGGGGAAGCCGCAGCGCGGCCTCCCGGCCAGCCAGCCGCCCAGC
CGCGCCCTCTGCCCACCCGCCCGCGCACCCACCGCCCTCGGCAGCCGCCC
CAGCCCCCGCCCCTTCGGGCCAGCCGGGGCTCATGGCTCAGATGGCGACC
ACGGCCGCAGGGGTAGCCGTGGGCTCGGCTGTGGGACACGTCATGGGCAG
CGCCCTGACCGGAGCCTTCAGCGGGGGGAGCTCGGAGCCCTCCCAGCCTG
CTGTCCAGCAGGCCCCCACCCCCGCTGCCCCCCAGCCCCTGCAGATGGGG
CCCTGCGCCTACGAGATCAGGCAGTTCCTGGACTGTTCCACCACTCAGAG
TGACCTGTCCCTGTGTGAGGGCTTCAGCGAGGCCCTGAAGCAGTGCAAGT
ACTACCATGGTCTGAGCTCCCTGCCCTTGCCAACTTTCTTGTACAAAGTG
GTGAGCTCCGCCACCATGGATCTCCACCGCGGTGGAGGCCGCATCTTTTA
CCCATACGATGTTCCTGACTATGCGGGCTATCCCTATGACGTCCCGGACT
ATGCAGGATCCTATCCATATGACGTTCCAGATTACGCTGCTCATGCCGGG
CACCGGTCCACGTGA
MPRGSRSAASRPASRPAAPSAHPPAHPPPSAAAPAPAPSGQPGLMAQMAT
TAAGVAVGSAVGHVMGSALTGAFSGGSSEPSQPAVQQAPTPAAPQPLQMG
PCAYEIRQFLDCSTTQSDLSLCEGFSEALKQCKYYHGLSSLPLPTFLYKV
VSSATMDLHRGGGRIFYPYDVPDYAGYPYDVPDYAGSYPYDVPDYAAHAG
HRST*

Index