Stock Number Hs1486

Human Gene: PRKAR1A


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
PRKAR1A protein kinase cAMP-dependent type I regulatory subunit alpha HGNC:9388 17q24.2 Pka-R1 3L

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03604 pGW-HA.attB ENST00000358598.6 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK37166207284877

Sequences

DNA sequence (1377 bp) Protein sequence (459 aa)
ATGGAGTCTGGCAGTACCGCCGCCAGTGAGGAGGCACGCAGCCTTCGAGA
ATGTGAGCTCTACGTCCAGAAGCATAACATTCAAGCGCTGCTCAAAGATT
CTATTGTGCAGTTGTGCACTGCTCGACCTGAGAGACCCATGGCATTCCTC
AGGGAATACTTTGAGAGGTTGGAGAAGGAGGAGGCAAAACAGATTCAGAA
TCTGCAGAAAGCAGGCACTCGTACAGACTCAAGGGAGGATGAGATTTCTC
CTCCTCCACCCAACCCAGTGGTTAAAGGTAGGAGGCGACGAGGTGCTATC
AGCGCTGAGGTCTACACGGAGGAAGATGCGGCATCCTATGTTAGAAAGGT
TATACCAAAAGATTACAAGACAATGGCCGCTTTAGCCAAAGCCATTGAAA
AGAATGTGCTGTTTTCACATCTTGATGATAATGAGAGAAGTGATATTTTT
GATGCCATGTTTTCGGTCTCCTTTATCGCAGGAGAGACTGTGATTCAGCA
AGGTGATGAAGGGGATAACTTCTATGTGATTGATCAAGGAGAGACGGATG
TCTATGTTAACAATGAATGGGCAACCAGTGTTGGGGAAGGAGGGAGCTTT
GGAGAACTTGCTTTGATTTATGGAACACCGAGAGCAGCCACTGTCAAAGC
AAAGACAAATGTGAAATTGTGGGGCATCGACCGAGACAGCTATAGAAGAA
TCCTCATGGGAAGCACACTGAGAAAGCGGAAGATGTATGAGGAATTCCTT
AGTAAAGTCTCTATTTTAGAGTCTCTGGACAAGTGGGAACGTCTTACGGT
AGCTGATGCATTGGAACCAGTGCAGTTTGAAGATGGGCAGAAGATTGTGG
TGCAGGGAGAACCAGGGGATGAGTTCTTCATTATTTTAGAGGGGTCAGCT
GCTGTGCTACAACGTCGGTCAGAAAATGAAGAGTTTGTTGAAGTGGGAAG
ATTGGGGCCTTCTGATTATTTTGGTGAAATTGCACTACTGATGAATCGTC
CTCGTGCTGCCACAGTTGTTGCTCGTGGCCCCTTGAAGTGCGTTAAGCTG
GACCGACCTAGATTTGAACGTGTTCTTGGCCCATGCTCAGACATCCTCAA
ACGAAACATCCAGCAGTACAACAGTTTTGTGTCACTGTCTGTCTGCCCAA
CTTTCTTGTACAAAGTGGTGGTACCTCGAAGTTCCTATTCTCTACTTAGT
ATAGGAACTTCCATCCTTGGAGCTCCTTCAGGAGGCGGTGCTACTGCTGG
CGCTGGTGGAGCCGGTGGACCTGCGGGGTTAATTTACCCATACGATGTTC
CTGACTATGCGGGCTATCCCTATGACGTCCCGGACTATGCAGGATCCTAT
CCATATGACGTTCCAGATTACGCTTGA
MESGSTAASEEARSLRECELYVQKHNIQALLKDSIVQLCTARPERPMAFL
REYFERLEKEEAKQIQNLQKAGTRTDSREDEISPPPPNPVVKGRRRRGAI
SAEVYTEEDAASYVRKVIPKDYKTMAALAKAIEKNVLFSHLDDNERSDIF
DAMFSVSFIAGETVIQQGDEGDNFYVIDQGETDVYVNNEWATSVGEGGSF
GELALIYGTPRAATVKAKTNVKLWGIDRDSYRRILMGSTLRKRKMYEEFL
SKVSILESLDKWERLTVADALEPVQFEDGQKIVVQGEPGDEFFIILEGSA
AVLQRRSENEEFVEVGRLGPSDYFGEIALLMNRPRAATVVARGPLKCVKL
DRPRFERVLGPCSDILKRNIQQYNSFVSLSVCPTFLYKVVVPRSSYSLLS
IGTSILGAPSGGGATAGAGGAGGPAGLIYPYDVPDYAGYPYDVPDYAGSY
PYDVPDYA*

Index