Stock Number Hs1485

Human Gene: LHX9


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
LHX9 LIM homeobox 9 HGNC:14222 1q31.3 ap 2R

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03680 pGW-HA.attB ENST00000475727.1 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK33166207184876

Sequences

DNA sequence (1425 bp) Protein sequence (475 aa)
ATGGAAATAGTGGGGTGCCGAGCAGAAGACAACTCGTGTCCTTTCCGCCC
CCCAGCCATGCTCTTTCACGGGATCTCCGGAGGCCACATCCAAGGCATCA
TGGAGGAGATGGAGCGCAGATCCAAGACTGAGGCCCGTCTGGCCAAAGGC
GCCCAGCTCAACGGCCGCGACGCGGGCATGCCCCCGCTCAGCCCGGAGAA
GCCCGCCCTGTGCGCCGGCTGCGGGGGCAAGATCTCGGACAGGTACTATC
TGCTGGCTGTGGACAAACAGTGGCATCTGAGATGCCTGAAGTGCTGTGAA
TGTAAGCTGGCCCTCGAGTCCGAGCTCACCTGCTTTGCCAAGGACGGTAG
CATTTACTGCAAGGAGGATTACTACAGAAGGTTCTCTGTGCAGAGATGTG
CCCGCTGCCACCTTGGCATTTCCGCCTCGGAGATGGTCATGCGCGCCCGA
GACTCTGTCTACCACCTGAGCTGCTTCACCTGCTCCACTTGCAACAAGAC
TCTGACCACGGGCGACCATTTCGGCATGAAGGACAGCCTGGTGTACTGCC
GCGCCCACTTCGAGACCCTCTTGCAAGGAGAGTATCCACCGCAGCTGAGC
TACACGGAGCTGGCGGCCAAGAGCGGCGGCCTGGCCCTGCCTTACTTCAA
CGGTACGGGCACCGTGCAGAAAGGGCGGCCCCGGAAGCGGAAGAGCCCAG
CGCTGGGAGTGGACATCGTCAATTACAACTCAGGTTGTAATGAGAATGAG
GCAGACCACTTGGACCGGGACCAGCAGCCTTATCCACCCTCGCAGAAGAC
CAAGCGCATGCGAACCTCTTTCAAGCATCACCAGCTCCGGACCATGAAAT
CCTACTTTGCCATCAACCACAACCCGGATGCCAAGGACCTCAAGCAGCTT
GCCCAGAAAACAGGTCTGACCAAAAGAGTTTTGCAGGTTTGGTTCCAAAA
CGCACGAGCCAAATTCAGAAGGAACCTTTTGCGGCAGGAGAATGGGGGTG
TTGATAAAGCTGACGGCACGTCGCTTCCGGCCCCGCCCTCAGCAGACAGC
GGAGCTCTCACTCCACCCGGCACTGCGACCACTTTAACAGACCTGACCAA
TCCCACTATCACTGTAGTGACATCCGTGACCTCTAACATGGACAGCCACG
AATCCGGAAGCCCCTCACAAACTACCTTAACAAACCTTTTCTTGCCAACT
TTCTTGTACAAAGTGGTGGTACCTCGAAGTTCCTATTCTCTACTTAGTAT
AGGAACTTCCATCCTTGGAGCTCCTTCAGGAGGCGGTGCTACTGCTGGCG
CTGGTGGAGCCGGTGGACCTGCGGGGTTAATTTACCCATACGATGTTCCT
GACTATGCGGGCTATCCCTATGACGTCCCGGACTATGCAGGATCCTATCC
ATATGACGTTCCAGATTACGCTTGA
MEIVGCRAEDNSCPFRPPAMLFHGISGGHIQGIMEEMERRSKTEARLAKG
AQLNGRDAGMPPLSPEKPALCAGCGGKISDRYYLLAVDKQWHLRCLKCCE
CKLALESELTCFAKDGSIYCKEDYYRRFSVQRCARCHLGISASEMVMRAR
DSVYHLSCFTCSTCNKTLTTGDHFGMKDSLVYCRAHFETLLQGEYPPQLS
YTELAAKSGGLALPYFNGTGTVQKGRPRKRKSPALGVDIVNYNSGCNENE
ADHLDRDQQPYPPSQKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQL
AQKTGLTKRVLQVWFQNARAKFRRNLLRQENGGVDKADGTSLPAPPSADS
GALTPPGTATTLTDLTNPTITVVTSVTSNMDSHESGSPSQTTLTNLFLPT
FLYKVVVPRSSYSLLSIGTSILGAPSGGGATAGAGGAGGPAGLIYPYDVP
DYAGYPYDVPDYAGSYPYDVPDYA*

Index