Stock Number Hs1484

Human Gene: CYTH1


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
CYTH1 cytohesin 1 HGNC:9501 17q25.3 step 2L

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03679 pGW-HA.attB ENST00000585509.5 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK33166207084875

Sequences

DNA sequence (1434 bp) Protein sequence (478 aa)
ATGGAGGAGGACGACAGCTACGTTCCCAGTGACCTGACAGCAGAGGAGCG
TCAAGAACTGGAGAACATCCGACGGAGAAAACAGGAGCTGCTGGCTGACA
TTCAGAGGCTGAAGGATGAGATAGCAGAAGTAGCTAATGAAATTGAAAAC
CTGGGATCCACAGAGGAAAGGAAAAACATGCAGAGGAACAAACAGGTAGC
CATGGGCAGGAAAAAATTTAATATGGACCCTAAAAAGGGGATCCAGTTCT
TAATAGAGAACGACCTCCTGAAGAACACTTGTGAAGACATTGCCCAGTTC
TTATATAAAGGCGAAGGGCTCAACAAGACAGCCATCGGCGACTACCTAGG
GGAGAGAGATGAGTTTAATATCCAGGTTCTTCATGCATTTGTGGAGCTGC
ATGAGTTCACTGATCTTAATCTCGTCCAGGCACTACGGCAGTTCCTGTGG
AGCTTCCGGCTACCCGGAGAGGCCCAGAAGATCGACCGGATGATGGAGGC
GTTTGCCCAGCGATATTGTCAGTGCAATAATGGCGTGTTCCAGTCCACGG
ATACTTGTTACGTCCTCTCCTTTGCCATCATCATGTTGAACACCAGTCTG
CACAACCCCAATGTCAAAGATAAGCCCACTGTGGAGAGGTTCATTGCCAT
GAACCGAGGCATCAATGATGGGGGAGACCTGCCGGAGGAGCTCCTCCGGA
ATCTCTATGAGAGCATAAAAAATGAACCCTTTAAAATCCCAGAAGACGAC
GGGAATGACCTCACTCACACTTTCTTCAATCCAGACCGAGAAGGCTGGCT
ATTGAAACTCGGAGGTGGCAGGGTAAAGACTTGGAAGAGACGCTGGTTCA
TTCTGACTGACAACTGCCTTTACTACTTTGAGTATACCACGGATAAGGAG
CCCCGTGGAATCATCCCTTTAGAGAATCTGAGTATCCGGGAAGTGGAGGA
CTCCAAAAAACCAAACTGCTTTGAGCTTTATATCCCCGACAATAAAGACC
AAGTTATCAAGGCCTGCAAGACCGAGGCTGACGGGCGGGTGGTGGAGGGG
AACCACACTGTTTACCGGATCTCAGCTCCGACGCCCGAGGAGAAGGAGGA
GTGGATTAAGTGCATTAAAGCAGCCATCAGCAGGGACCCTTTCTACGAAA
TGCTCGCAGCACGGAAAAAGAAGGTCTCCTCCACGAAGCGACACTGGATC
CACCCGGCTTTCTTGTACAAAGTGGTGGTACCTCGAAGTTCCTATTCTCT
ACTTAGTATAGGAACTTCCATCCTTGGAGCTCCTTCAGGAGGCGGTGCTA
CTGCTGGCGCTGGTGGAGCCGGTGGACCTGCGGGGTTAATTTACCCATAC
GATGTTCCTGACTATGCGGGCTATCCCTATGACGTCCCGGACTATGCAGG
ATCCTATCCATATGACGTTCCAGATTACGCTTGA
MEEDDSYVPSDLTAEERQELENIRRRKQELLADIQRLKDEIAEVANEIEN
LGSTEERKNMQRNKQVAMGRKKFNMDPKKGIQFLIENDLLKNTCEDIAQF
LYKGEGLNKTAIGDYLGERDEFNIQVLHAFVELHEFTDLNLVQALRQFLW
SFRLPGEAQKIDRMMEAFAQRYCQCNNGVFQSTDTCYVLSFAIIMLNTSL
HNPNVKDKPTVERFIAMNRGINDGGDLPEELLRNLYESIKNEPFKIPEDD
GNDLTHTFFNPDREGWLLKLGGGRVKTWKRRWFILTDNCLYYFEYTTDKE
PRGIIPLENLSIREVEDSKKPNCFELYIPDNKDQVIKACKTEADGRVVEG
NHTVYRISAPTPEEKEEWIKCIKAAISRDPFYEMLAARKKKVSSTKRHWI
HPAFLYKVVVPRSSYSLLSIGTSILGAPSGGGATAGAGGAGGPAGLIYPY
DVPDYAGYPYDVPDYAGSYPYDVPDYA*

Index