Stock Number Hs1483

Human Gene: SETDB1


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
SETDB1 SET domain bifurcated 1 HGNC:10761 1q21.3 egg 2R

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03678 pGW-HA.attB ENST00000448029.5 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK33166206984874

Sequences

DNA sequence (1425 bp) Protein sequence (475 aa)
ATGTCTTCCCTTCCTGGGTGCATTGGTTTGGATGCAGCAACAGCTACAGT
GGAGTCTGAAGAGATTGCAGAGCTGCAACAGGCAGTGGTTGAGGAACTGG
GTATCTCTATGGAGGAACTTCGGCATTTCATCGATGAGGAACTGGAGAAG
ATGGATTGTGTACAGCAACGCAAGAAGCAGCTAGCAGAGTTAGAGACATG
GGTAATACAGAAAGAATCTGAGGTGGCTCACGTTGACCAACTCTTTGATG
ATGCATCCAGGGCAGTGACTAATTGTGAGTCTTTGGTGAAGGACTTCTAC
TCCAAGCTGGGACTACAATACCGGGACAGTAGCTCTGAGGACGAATCTTC
CCGGCCTACAGAAATAATTGAGATTCCTGATGAAGATGATGATGTCCTCA
GTATTGATTCAGGTGATGCTGGGAGCAGAACTCCAAAAGACCAGAAGCTC
CGTGAAGCTATGGCTGCCTTAAGAAAGTCAGCTCAAGATGTTCAGAAGTT
CATGGATGCTGTCAACAAGAAGAGCAGTTCCCAGGATCTGCATAAAGGAA
CCTTGAGTCAGATGTCTGGAGAACTAAGCAAAGATGGTGACCTGATAGTC
AGCATGCGAATTCTGGGCAAGAAGAGAACTAAGACTTGGCACAAAGGCAC
CCTTATTGCCATCCAGACAGTTGGGCCAGGGAAGAAATACAAGGTGAAAT
TTGACAACAAAGGAAAGAGTCTACTGTCGGGGAACCATATTGCCTATGAT
TACCACCCTCCTGCTGACAAGCTGTATGTGGGCAGTCGGGTGGTCGCCAA
ATACAAAGATGGGAATCAGGTCTGGCTCTATGCTGGCATTGTAGCTGAGA
CACCAAACGTCAAAAACAAGCTCAGGTTTCTCATTTTCTTTGATGATGGC
TATGCTTCCTATGTCACACAGTCGGAACTGTATCCCATTTGCCGGCCACT
GAAAAAGACTTGGGAGGACATAGAAGACATCTCCTGCCGTGACTTCATAG
AGGAGTATGTCACTGCCTACCCCAACCGCCCCATGGTACTGCTCAAGAGT
GGCCAGCTTATCAAGACTGAGTGGGAAGGCACGTGGTGGAAGTCCCGAGT
TGAGGAGGTGGATGGCAGCCTAGTCAGGATCCTCTTCCTGGTACTGTTCT
TCTCTACAATTTTGGAGGCAGAGGTTGGTGGGGGGGGAACTTACCCAACT
TTCTTGTACAAAGTGGTGGTACCTCGAAGTTCCTATTCTCTACTTAGTAT
AGGAACTTCCATCCTTGGAGCTCCTTCAGGAGGCGGTGCTACTGCTGGCG
CTGGTGGAGCCGGTGGACCTGCGGGGTTAATTTACCCATACGATGTTCCT
GACTATGCGGGCTATCCCTATGACGTCCCGGACTATGCAGGATCCTATCC
ATATGACGTTCCAGATTACGCTTGA
MSSLPGCIGLDAATATVESEEIAELQQAVVEELGISMEELRHFIDEELEK
MDCVQQRKKQLAELETWVIQKESEVAHVDQLFDDASRAVTNCESLVKDFY
SKLGLQYRDSSSEDESSRPTEIIEIPDEDDDVLSIDSGDAGSRTPKDQKL
REAMAALRKSAQDVQKFMDAVNKKSSSQDLHKGTLSQMSGELSKDGDLIV
SMRILGKKRTKTWHKGTLIAIQTVGPGKKYKVKFDNKGKSLLSGNHIAYD
YHPPADKLYVGSRVVAKYKDGNQVWLYAGIVAETPNVKNKLRFLIFFDDG
YASYVTQSELYPICRPLKKTWEDIEDISCRDFIEEYVTAYPNRPMVLLKS
GQLIKTEWEGTWWKSRVEEVDGSLVRILFLVLFFSTILEAEVGGGGTYPT
FLYKVVVPRSSYSLLSIGTSILGAPSGGGATAGAGGAGGPAGLIYPYDVP
DYAGYPYDVPDYAGSYPYDVPDYA*

Index