Stock Number Hs1482

Human Gene: DNAJA1


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
DNAJA1 DnaJ heat shock protein family (Hsp40) member A1 HGNC:5229 9p21.1 Droj2 3R

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03677 pGW-HA.attB ENST00000330899.4 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK37166206884873

Sequences

DNA sequence (1425 bp) Protein sequence (475 aa)
ATGGTGAAAGAAACAACTTACTACGATGTTTTGGGGGTCAAACCCAATGC
TACTCAGGAAGAATTGAAAAAGGCTTATAGGAAACTGGCCTTGAAGTACC
ATCCTGATAAGAACCCAAATGAAGGAGAGAAGTTTAAACAGATTTCTCAA
GCTTACGAAGTTCTCTCTGATGCAAAGAAAAGGGAATTATATGACAAAGG
AGGAGAACAGGCAATTAAAGAGGGTGGAGCAGGTGGCGGTTTTGGCTCCC
CCATGGACATCTTTGATATGTTTTTTGGAGGAGGAGGAAGGATGCAGAGA
GAAAGGAGAGGTAAAAATGTTGTACATCAGCTCTCAGTAACCCTAGAAGA
CTTATATAATGGTGCAACAAGAAAACTGGCTCTGCAAAAGAATGTGATTT
GTGACAAATGTGAAGGTAGAGGAGGTAAGAAAGGAGCAGTAGAGTGCTGT
CCCAATTGCCGAGGTACTGGAATGCAAATAAGAATTCATCAGATAGGACC
TGGAATGGTTCAGCAAATTCAGTCTGTGTGCATGGAGTGCCAGGGCCATG
GGGAGCGGATCAGTCCTAAAGATAGATGTAAAAGCTGCAACGGAAGGAAG
ATAGTTCGAGAGAAGAAAATTTTAGAAGTTCATATTGACAAAGGCATGAA
AGATGGCCAGAAGATAACATTCCATGGTGAAGGAGACCAAGAACCAGGAC
TGGAGCCAGGCGATATTATCATTGTGTTAGATCAGAAGGACCATGCTGTT
TTTACTCGACGAGGAGAAGACCTTTTCATGTGTATGGACATACAGCTCGT
TGAAGCACTGTGTGGCTTCCAGAAGCCAATATCTACTCTTGACAACCGAA
CCATCGTCATCACCTCTCATCCAGGTCAGATTGTCAAGCATGGAGATATC
AAGTGTGTACTAAATGAAGGCATGCCAATTTATCGTAGACCATATGAAAA
GGGTCGCCTAATCATCGAATTTAAGGTAAACTTTCCTGAGAATGGCTTTC
TCTCTCCTGATAAACTGTCTTTGCTGGAAAAACTCCTACCCGAGAGGAAG
GAAGTGGAAGAGACTGATGAGATGGACCAAGTAGAACTGGTGGACTTTGA
TCCAAATCAGGAAAGACGGCGCCACTACAATGGAGAAGCATATGAGGATG
ATGAACATCATCCCAGAGGTGGTGTTCAGTGTCAGACCTCTTACCCAACT
TTCTTGTACAAAGTGGTGGTACCTCGAAGTTCCTATTCTCTACTTAGTAT
AGGAACTTCCATCCTTGGAGCTCCTTCAGGAGGCGGTGCTACTGCTGGCG
CTGGTGGAGCCGGTGGACCTGCGGGGTTAATTTACCCATACGATGTTCCT
GACTATGCGGGCTATCCCTATGACGTCCCGGACTATGCAGGATCCTATCC
ATATGACGTTCCAGATTACGCTTGA
MVKETTYYDVLGVKPNATQEELKKAYRKLALKYHPDKNPNEGEKFKQISQ
AYEVLSDAKKRELYDKGGEQAIKEGGAGGGFGSPMDIFDMFFGGGGRMQR
ERRGKNVVHQLSVTLEDLYNGATRKLALQKNVICDKCEGRGGKKGAVECC
PNCRGTGMQIRIHQIGPGMVQQIQSVCMECQGHGERISPKDRCKSCNGRK
IVREKKILEVHIDKGMKDGQKITFHGEGDQEPGLEPGDIIIVLDQKDHAV
FTRRGEDLFMCMDIQLVEALCGFQKPISTLDNRTIVITSHPGQIVKHGDI
KCVLNEGMPIYRRPYEKGRLIIEFKVNFPENGFLSPDKLSLLEKLLPERK
EVEETDEMDQVELVDFDPNQERRRHYNGEAYEDDEHHPRGGVQCQTSYPT
FLYKVVVPRSSYSLLSIGTSILGAPSGGGATAGAGGAGGPAGLIYPYDVP
DYAGYPYDVPDYAGSYPYDVPDYA*

Index