Stock Number Hs1481

Human Gene: GPR84


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
GPR84 G protein-coupled receptor 84 HGNC:4535 12q13.13 Tre1 X

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03675 pGW-HA.attB ENST00000551809.1 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK37166206784872

Sequences

DNA sequence (1422 bp) Protein sequence (474 aa)
ATGTGGAACAGCTCTGACGCCAACTTCTCCTGCTACCATGAGTCTGTGCT
GGGCTATCGTTATGTTGCAGTTAGCTGGGGGGTGGTGGTGGCTGTGACAG
GCACCGTGGGCAATGTGCTCACCCTACTGGCCTTGGCCATCCAGCCCAAG
CTCCGTACCCGATTCAACCTGCTCATAGCCAACCTCACACTGGCTGATCT
CCTCTACTGCACGCTCCTTCAGCCCTTCTCTGTGGACACCTACCTCCACC
TGCACTGGCGCACCGGTGCCACCTTCTGCAGGGTATTTGGGCTCCTCCTT
TTTGCCTCCAATTCTGTCTCCATCCTGACCCTCTGCCTCATCGCACTGGG
ACGCTACCTCCTCATTGCCCACCCTAAGCTTTTTCCCCAAGTTTTCAGTG
CCAAGGGGATAGTGCTGGCACTGGTGAGCACCTGGGTTGTGGGCGTGGCC
AGCTTTGCTCCCCTCTGGCCTATTTATATCCTGGTACCTGTAGTCTGCAC
CTGCAGCTTTGACCGCATCCGAGGCCGGCCTTACACCACCATCCTCATGG
GCATCTACTTTGTGCTTGGGCTCAGCAGTGTTGGCATCTTCTATTGCCTC
ATCCACCGCCAGGTCAAACGAGCAGCACAGGCACTGGACCAATACAAGTT
GCGACAGGCAAGCATCCACTCCAACCATGTGGCCAGGACTGATGAGGCCA
TGCCTGGTCGTTTCCAGGAGCTGGACAGCAGGTTAGCATCAGGAGGACCC
AGTGAGGGGATTTCATCTGAGCCAGTCAGTGCTGCCACCACCCAGACCCT
GGAAGGGGACTCATCAGAAGTGGGAGACCAGATCAACAGCAAGAGAGCTA
AGCAGATGGCAGAGAAAAGCCCTCCAGAAGCATCTGCCAAAGCCCAGCCA
ATTAAAGGAGCCAGAAGAGCTCCGGATTCTTCATCGGAATTTGGGAAGGT
GACTCGAATGTGTTTTGCTGTGTTCCTCTGCTTTGCCCTGAGCTACATCC
CCTTCTTGCTGCTCAACATTCTGGATGCCAGAGTCCAGGCTCCCCGGGTG
GTCCACATGCTTGCTGCCAACCTCACCTGGCTCAATGGTTGCATCAACCC
TGTGCTCTATGCAGCCATGAACCGCCAATTCCGCCAAGCATATGGCTCCA
TTTTAAAAAGAGGGCCCCGGAGTTTCCATAGGCTCCATTACCCAACTTTC
TTGTACAAAGTGGTGGTACCTCGAAGTTCCTATTCTCTACTTAGTATAGG
AACTTCCATCCTTGGAGCTCCTTCAGGAGGCGGTGCTACTGCTGGCGCTG
GTGGAGCCGGTGGACCTGCGGGGTTAATTTACCCATACGATGTTCCTGAC
TATGCGGGCTATCCCTATGACGTCCCGGACTATGCAGGATCCTATCCATA
TGACGTTCCAGATTACGCTTGA
MWNSSDANFSCYHESVLGYRYVAVSWGVVVAVTGTVGNVLTLLALAIQPK
LRTRFNLLIANLTLADLLYCTLLQPFSVDTYLHLHWRTGATFCRVFGLLL
FASNSVSILTLCLIALGRYLLIAHPKLFPQVFSAKGIVLALVSTWVVGVA
SFAPLWPIYILVPVVCTCSFDRIRGRPYTTILMGIYFVLGLSSVGIFYCL
IHRQVKRAAQALDQYKLRQASIHSNHVARTDEAMPGRFQELDSRLASGGP
SEGISSEPVSAATTQTLEGDSSEVGDQINSKRAKQMAEKSPPEASAKAQP
IKGARRAPDSSSEFGKVTRMCFAVFLCFALSYIPFLLLNILDARVQAPRV
VHMLAANLTWLNGCINPVLYAAMNRQFRQAYGSILKRGPRSFHRLHYPTF
LYKVVVPRSSYSLLSIGTSILGAPSGGGATAGAGGAGGPAGLIYPYDVPD
YAGYPYDVPDYAGSYPYDVPDYA*

Index