Stock Number Hs1480

Human Gene: PDHA1


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
PDHA1 pyruvate dehydrogenase E1 alpha 1 subunit HGNC:8806 Xp22.12 Pdha X

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03640 pGW-HA.attB ENST00000422285.6 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK37166206684871

Sequences

DNA sequence (1404 bp) Protein sequence (468 aa)
ATGAGGAAGATGCTCGCCGCCGTCTCCCGCGTGCTGTCTGGCGCTTCTCA
GAAGCCGGCAAGCAGAGTGCTGGTAGCATCCCGTAATTTTGCAAATGATG
CTACATTTGAAATTAAGAAATGTGACCTTCACCGGCTGGAAGAAGGCCCT
CCTGTCACAACAGTGCTCACCAGGGAGGATGGGCTCAAATACTACAGGAT
GATGCAGACTGTACGCCGAATGGAGTTGAAAGCAGATCAGCTGTATAAAC
AGAAAATTATTCGTGGTTTCTGTCACTTGTGTGATGGTCAGGAAGCTTGC
TGTGTGGGCCTGGAGGCCGGCATCAACCCCACAGACCATCTCATCACAGC
CTACCGGGCTCACGGCTTTACTTTCACCCGGGGCCTTTCCGTCCGAGAAA
TTCTCGCAGAGCTTACAGGACGAAAAGGAGGTTGTGCTAAAGGGAAAGGA
GGATCGATGCACATGTATGCCAAGAACTTCTACGGGGGCAATGGCATCGT
GGGAGCGCAGGTGCCCCTGGGCGCTGGGATTGCTCTAGCCTGTAAGTATA
ATGGAAAAGATGAGGTCTGCCTGACTTTATATGGCGATGGTGCTGCTAAC
CAGGGCCAGATATTCGAAGCTTACAACATGGCAGCTTTGTGGAAATTACC
TTGTATTTTCATCTGTGAGAATAATCGCTATGGAATGGGAACGTCTGTTG
AGAGAGCGGCAGCCAGCACTGATTACTACAAGAGAGGCGATTTCATTCCT
GGGCTGAGAGTGGATGGAATGGATATCCTGTGCGTCCGAGAGGCAACAAG
GTTTGCTGCTGCCTATTGTAGATCTGGGAAGGGGCCCATCCTGATGGAGC
TGCAGACTTACCGTTACCACGGACACAGTATGAGTGACCCTGGAGTCAGT
TACCGTACACGAGAAGAAATTCAGGAAGTAAGAAGTAAGAGTGACCCTAT
TATGCTTCTCAAGGACAGGATGGTGAACAGCAATCTTGCCAGTGTGGAAG
AACTAAAGGAAATTGATGTGGAAGTGAGGAAGGAGATTGAGGATGCTGCC
CAGTTTGCCACGGCCGATCCTGAGCCACCTTTGGAAGAGCTGGGCTACCA
CATCTACTCCAGCGACCCACCTTTTGAAGTTCGTGGTGCCAATCAGTGGA
TCAAGTTTAAGTCAGTCAGTTACCCAACTTTCTTGTACAAAGTGGTGGTA
CCTCGAAGTTCCTATTCTCTACTTAGTATAGGAACTTCCATCCTTGGAGC
TCCTTCAGGAGGCGGTGCTACTGCTGGCGCTGGTGGAGCCGGTGGACCTG
CGGGGTTAATTTACCCATACGATGTTCCTGACTATGCGGGCTATCCCTAT
GACGTCCCGGACTATGCAGGATCCTATCCATATGACGTTCCAGATTACGC
TTGA
MRKMLAAVSRVLSGASQKPASRVLVASRNFANDATFEIKKCDLHRLEEGP
PVTTVLTREDGLKYYRMMQTVRRMELKADQLYKQKIIRGFCHLCDGQEAC
CVGLEAGINPTDHLITAYRAHGFTFTRGLSVREILAELTGRKGGCAKGKG
GSMHMYAKNFYGGNGIVGAQVPLGAGIALACKYNGKDEVCLTLYGDGAAN
QGQIFEAYNMAALWKLPCIFICENNRYGMGTSVERAAASTDYYKRGDFIP
GLRVDGMDILCVREATRFAAAYCRSGKGPILMELQTYRYHGHSMSDPGVS
YRTREEIQEVRSKSDPIMLLKDRMVNSNLASVEELKEIDVEVRKEIEDAA
QFATADPEPPLEELGYHIYSSDPPFEVRGANQWIKFKSVSYPTFLYKVVV
PRSSYSLLSIGTSILGAPSGGGATAGAGGAGGPAGLIYPYDVPDYAGYPY
DVPDYAGSYPYDVPDYA*

Index