Stock Number Hs1479

Human Gene: HS3ST3B1


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
HS3ST3B1 heparan sulfate-glucosamine 3-sulfotransferase 3B1 HGNC:5198 17p12 Hs3st-B X

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03639 pGW-HA.attB ENST00000466596.5 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK37166206584870

Sequences

DNA sequence (1404 bp) Protein sequence (468 aa)
ATGGGGCAGCGCCTGAGTGGCGGCAGATCTTGCCTCGATGTCCCCGGCCG
GCTCCTACCGCAGCCGCCGCCGCCCCCGCCGCCGGTGAGGAGGAAGCTCG
CGCTGCTCTTCGCCATGCTCTGCGTCTGGCTCTATATGTTCCTGTACTCG
TGCGCCGGCTCCTGCGCCGCCGCGCCGGGGCTGCTGCTCCTGGGCTCTGG
GTCCCGCGCCGCACACGACCCGCCAGCCCTGGCCACAGCTCCGGACGGGA
CGCCCCCCAGGCTGCCGTTCCGGGCGCCGCCAGCCACCCCACTGGCTTCA
GGCAAGGAGATGGCCGAGGGCGCTGCGAGCCCGGAGGAGCAGAGTCCCGA
GGTGCCGGACTCCCCAAGCCCCATCTCCAGCTTTTTCAGTGGGTCTGGGA
GCAAGCAGCTGCCGCAGGCCATCATCATCGGCGTGAAGAAGGGCGGCACG
CGGGCGCTGCTGGAGTTTCTGCGCGTGCACCCCGACGTGCGCGCCGTGGG
CGCCGAGCCCCATTTCTTCGATCGCAGCTACGACAAGGGCCTCGCTTGGT
ACCGGGACCTGATGCCCAGAACCCTGGACGGGCAGATCACCATGGAGAAG
ACGCCCAGTTACTTCGTCACGCGGGAGGCCCCTGCGCGCATCTCGGCCAT
GTCCAAGGACACCAAGCTCATCGTGGTGGTGCGGGACCCGGTGACCAGGG
CCATCTCGGACTACACGCAGACGCTGTCCAAGCGGCCCGACATCCCCACC
TTCGAGAGCTTGACGTTCAAAAACAGGACAGCGGGCCTCATCGACACGTC
GTGGAGCGCCATCCAGATCGGCATCTACGCCAAGCACCTGGAGCACTGGC
TGCGCCACTTCCCCATCCGCCAGATGCTCTTCGTGAGCGGCGAGCGGCTC
ATCAGCGACCCGGCCGGGGAGCTGGGCCGCGTGCAAGACTTCCTGGGCCT
CAAGAGGATCATCACGGACAAGCACTTCTACTTCAACAAGACCAAGGGCT
TCCCCTGCCTGAAGAAGGCGGAGGGCAGCAGCCGGCCCCATTGCCTGGGC
AAGACCAAGGGCAGGACCCATCCTGAGATCGACCGCGAGGTGGTGCGCAG
GCTGCGCGAGTTCTACCGGCCTTTCAACCTCAAGTTCTACCAGATGACCG
GGCACGACTTTGGCTGGGATTGCCCAACTTTCTTGTACAAAGTGGTGGTA
CCTCGAAGTTCCTATTCTCTACTTAGTATAGGAACTTCCATCCTTGGAGC
TCCTTCAGGAGGCGGTGCTACTGCTGGCGCTGGTGGAGCCGGTGGACCTG
CGGGGTTAATTTACCCATACGATGTTCCTGACTATGCGGGCTATCCCTAT
GACGTCCCGGACTATGCAGGATCCTATCCATATGACGTTCCAGATTACGC
TTGA
MGQRLSGGRSCLDVPGRLLPQPPPPPPPVRRKLALLFAMLCVWLYMFLYS
CAGSCAAAPGLLLLGSGSRAAHDPPALATAPDGTPPRLPFRAPPATPLAS
GKEMAEGAASPEEQSPEVPDSPSPISSFFSGSGSKQLPQAIIIGVKKGGT
RALLEFLRVHPDVRAVGAEPHFFDRSYDKGLAWYRDLMPRTLDGQITMEK
TPSYFVTREAPARISAMSKDTKLIVVVRDPVTRAISDYTQTLSKRPDIPT
FESLTFKNRTAGLIDTSWSAIQIGIYAKHLEHWLRHFPIRQMLFVSGERL
ISDPAGELGRVQDFLGLKRIITDKHFYFNKTKGFPCLKKAEGSSRPHCLG
KTKGRTHPEIDREVVRRLREFYRPFNLKFYQMTGHDFGWDCPTFLYKVVV
PRSSYSLLSIGTSILGAPSGGGATAGAGGAGGPAGLIYPYDVPDYAGYPY
DVPDYAGSYPYDVPDYA*

Index