Stock Number Hs1478

Human Gene: CSNK2A1


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
CSNK2A1 casein kinase 2 alpha 1 HGNC:2457 20p13 CkIIalpha 3L

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03647 pGW-HA.attB ENST00000400217.6 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK37166206484869

Sequences

DNA sequence (1407 bp) Protein sequence (469 aa)
ATGTCGGGACCCGTGCCAAGCAGGGCCAGAGTTTACACAGATGTTAATAC
ACACAGACCTCGAGAATACTGGGATTACGAGTCACATGTGGTGGAATGGG
GAAATCAAGATGACTACCAGCTGGTTCGAAAATTAGGCCGAGGTAAATAC
AGTGAAGTATTTGAAGCCATCAACATCACAAATAATGAAAAAGTTGTTGT
TAAAATTCTCAAGCCAGTAAAAAAGAAGAAAATTAAGCGTGAAATAAAGA
TTTTGGAGAATTTGAGAGGAGGTCCCAACATCATCACACTGGCAGACATT
GTAAAAGACCCTGTGTCACGAACCCCCGCCTTGGTTTTTGAACACGTAAA
CAACACAGACTTCAAGCAATTGTACCAGACGTTAACAGACTATGATATTC
GATTTTACATGTATGAGATTCTGAAGGCCCTGGATTATTGTCACAGCATG
GGAATTATGCACAGAGATGTCAAGCCCCATAATGTCATGATTGATCATGA
GCACAGAAAGCTACGACTAATAGACTGGGGTTTGGCTGAGTTTTATCATC
CTGGCCAAGAATATAATGTCCGAGTTGCTTCCCGATACTTCAAAGGTCCT
GAGCTACTTGTAGACTATCAGATGTACGATTATAGTTTGGATATGTGGAG
TTTGGGTTGTATGCTGGCAAGTATGATCTTTCGGAAGGAGCCATTTTTCC
ATGGACATGACAATTATGATCAGTTGGTGAGGATAGCCAAGGTTCTGGGG
ACAGAAGATTTATATGACTATATTGACAAATACAACATTGAATTAGATCC
ACGTTTCAATGATATCTTGGGCAGACACTCTCGAAAGCGATGGGAACGCT
TTGTCCACAGTGAAAATCAGCACCTTGTCAGCCCTGAGGCCTTGGATTTC
CTGGACAAACTGCTGCGATATGACCACCAGTCACGGCTTACTGCAAGAGA
GGCAATGGAGCACCCCTATTTCTACACTGTTGTGAAGGACCAGGCTCGAA
TGGGTTCATCTAGCATGCCAGGGGGCAGTACGCCCGTCAGCAGCGCCAAT
ATGATGTCAGGGATTTCTTCAGTGCCAACCCCTTCACCCCTTGGACCTCT
GGCAGGCTCACCAGTGATTGCTGCTGCCAACCCCCTTGGGATGCCTGTTC
CAGCTGCCGCTGGCGCTCAGCAGTACCTAACTTTCTTGTACAAAGTGGTG
GTACCTCGAAGTTCCTATTCTCTACTTAGTATAGGAACTTCCATCCTTGG
AGCTCCTTCAGGAGGCGGTGCTACTGCTGGCGCTGGTGGAGCCGGTGGAC
CTGCGGGGTTAATTTACCCATACGATGTTCCTGACTATGCGGGCTATCCC
TATGACGTCCCGGACTATGCAGGATCCTATCCATATGACGTTCCAGATTA
CGCTTGA
MSGPVPSRARVYTDVNTHRPREYWDYESHVVEWGNQDDYQLVRKLGRGKY
SEVFEAINITNNEKVVVKILKPVKKKKIKREIKILENLRGGPNIITLADI
VKDPVSRTPALVFEHVNNTDFKQLYQTLTDYDIRFYMYEILKALDYCHSM
GIMHRDVKPHNVMIDHEHRKLRLIDWGLAEFYHPGQEYNVRVASRYFKGP
ELLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGHDNYDQLVRIAKVLG
TEDLYDYIDKYNIELDPRFNDILGRHSRKRWERFVHSENQHLVSPEALDF
LDKLLRYDHQSRLTAREAMEHPYFYTVVKDQARMGSSSMPGGSTPVSSAN
MMSGISSVPTPSPLGPLAGSPVIAAANPLGMPVPAAAGAQQYLTFLYKVV
VPRSSYSLLSIGTSILGAPSGGGATAGAGGAGGPAGLIYPYDVPDYAGYP
YDVPDYAGSYPYDVPDYA*

Index