Stock Number Hs1477

Human Gene: NAP1L1


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
NAP1L1 nucleosome assembly protein 1 like 1 HGNC:7637 12q21.1 Nap1 2R

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03646 pGW-HA.attB ENST00000542344.5 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK331662063

Sequences

DNA sequence (1407 bp) Protein sequence (469 aa)
ATGGCAGACATTGACAACAAAGAACAGTCTGAACTTGATCAAGATTTGGA
TGATGTTGAAGAAGTAGAAGAAGAGGAAACTGGTGAAGAAACAAAACTCA
AAGCACGTCAGCTAACTGTTCAGATGATGCAAAATCCTCAGATTCTTGCA
GCCCTTCAAGAAAGACTTGATGGTCTGGTAGAAACACCAACAGGATACAT
TGAAAGCCTGCCTAGGGTAGTTAAAAGACGAGTGAATGCTCTCAAAAACC
TGCAAGTTAAATGTGCACAGATAGAAGCCAAATTCTATGAGGAAGTTCAT
GATCTTGAAAGGAAGTATGCTGTTCTCTATCAGCCTCTATTTGATAAGCG
ATTTGAAATTATTAATGCAATTTATGAACCTACGGAAGAAGAATGTGAAT
GGAAACCAGATGAAGAAGATGAGATTTCGGAGGAATTGAAAGAAAAGGCC
AAGATTGAAGATGAGAAAAAGGATGAAGAAAAAGAAGACCCCAAAGGAAT
TCCTGAATTTTGGTTAACTGTTTTTAAGAATGTTGACTTGCTCAGTGATA
TGGTTCAGGAACACGATGAACCTATTCTGAAGCACTTGAAAGATATTAAA
GTGAAGTTCTCAGATGCTGGCCAGCCTATGAGTTTTGTCTTAGAATTTCA
CTTTGAACCCAATGAATATTTTACAAATGAAGTGCTGACAAAGACATACA
GGATGAGGTCAGAACCAGATGATTCTGATCCCTTTTCTTTTGATGGACCA
GAAATTATGGGTTGTACAGGGTGCCAGATAGATTGGAAAAAAGGAAAGAA
TGTCACTTTGAAAACTATTAAGAAGAAGCAGAAACACAAGGGACGTGGGA
CAGTTCGTACTGTGACTAAAACAGTTTCCAATGACTCTTTCTTTAACTTT
TTTGCCCCTCCTGAAGTTCCTGAGAGTGGAGATCTGGATGATGATGCTGA
AGCTATCCTTGCTGCAGACTTCGAAATTGGTCACTTTTTACGTGAGCGTA
TAATCCCAAGATCAGTGTTATATTTTACTGGAGAAGCTATTGAAGATGAT
GATGATGATTATGATGAAGAAGGTGAAGAAGCGGATGAGGAAGGGGAAGA
AGAAGGAGATGAGGAAAATGATCCAGACTATGACCCAAAGAAGGATCAAA
ACCCAGCAGAGTGCAAGCAGCAGTGCCCAACTTTCTTGTACAAAGTGGTG
GTACCTCGAAGTTCCTATTCTCTACTTAGTATAGGAACTTCCATCCTTGG
AGCTCCTTCAGGAGGCGGTGCTACTGCTGGCGCTGGTGGAGCCGGTGGAC
CTGCGGGGTTAATTTACCCATACGATGTTCCTGACTATGCGGGCTATCCC
TATGACGTCCCGGACTATGCAGGATCCTATCCATATGACGTTCCAGATTA
CGCTTGA
MADIDNKEQSELDQDLDDVEEVEEEETGEETKLKARQLTVQMMQNPQILA
ALQERLDGLVETPTGYIESLPRVVKRRVNALKNLQVKCAQIEAKFYEEVH
DLERKYAVLYQPLFDKRFEIINAIYEPTEEECEWKPDEEDEISEELKEKA
KIEDEKKDEEKEDPKGIPEFWLTVFKNVDLLSDMVQEHDEPILKHLKDIK
VKFSDAGQPMSFVLEFHFEPNEYFTNEVLTKTYRMRSEPDDSDPFSFDGP
EIMGCTGCQIDWKKGKNVTLKTIKKKQKHKGRGTVRTVTKTVSNDSFFNF
FAPPEVPESGDLDDDAEAILAADFEIGHFLRERIIPRSVLYFTGEAIEDD
DDDYDEEGEEADEEGEEEGDEENDPDYDPKKDQNPAECKQQCPTFLYKVV
VPRSSYSLLSIGTSILGAPSGGGATAGAGGAGGPAGLIYPYDVPDYAGYP
YDVPDYAGSYPYDVPDYA*

Index