Stock Number Hs1475

Human Gene: PIK3AP1


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
PIK3AP1 phosphoinositide-3-kinase adaptor protein 1 HGNC:30034 10q24.1 stumps 3R

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03804 pGW-HA.attB ENST00000371109.3 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK37166206184867

Sequences

DNA sequence (1446 bp) Protein sequence (482 aa)
ATGAGGTTTTTCACCAGCGTGGCCTGCTATGGATCTTGTCTCTTTGCATC
TGAGTTGCTGATCAGATGCAAGGACTGGCTCAAAGGAAGACCAGCTCTCT
TCACTGCCCTGCTAGCTTGTGTCCTTTATCTTTGTGAGTGGACTGGTGCC
AAGCATGTCCCAGGGTCATCTTATGTTGAAATGCTTCAGGCCAGTACATC
TAACCCAATCCCTGGAGATGGTTTCTCTCGGGCCACTAAGGACTCTATGA
TCCGCAAGTTTTTAGAAGGCAACAGCATGGGAATGACCAATCTGGAGAGA
GATCAGTGCCATCTTGGTCAGGAAGAAGATGTTTATCACACGGTGGATGA
CGATGAGGCCTTTTCTGTGGACTTGGCCAGCAGGCCCCCTGTCCCAGTGC
CCAGACCAGAGACCACTGCTCCTGGTGCTCACCAGCTGCCTGACAACGAA
CCATACATTTTTAAAGTTTTTGCAGAAAAAAGTCAAGAGCGGCCTGGGAA
TTTCTACGTTTCCTCAGAGAGCATCAGGAAAGGGCCGCCCGTCAGACCAT
GGAGGGACAGGCCCCAGTCGAGTATATATGACCCTTTTGCGGGAATGAAA
ACGCCAGGCCAGCGGCAGCTTATCACCCTCCAGGAGCAGGTGAAGCTGGG
CATTGTCAACGTGGATGAGGCTGTGCTCCACTTCAAAGAGTGGCAGCTCA
ACCAGAAGAAACGATCGGAGTCCTTTCGTTTCCAGCAGGAAAATCTTAAA
CGGCTAAGAGACAGCATCACCCGAAGACAGAGAGAGAAGCAAAAATCAGG
AAAGCAGACAGACTTGGAGATCACGGTCCCAATTCGGCACTCACAGCACC
TGCCTGCAAAAGTGGAGTTTGGAGTCTATGAGAGTGGCCCCAGGAAAAGC
GTCATTCCCCCTAGGACGGAGCTGAGACGAGGAGACTGGAAAACAGACAG
CACCTCCAGCACAGCAAGTAGCACAAGTAACCGCTCCAGCACCCGGAGCC
TCCTCAGTGTGAGCAGCGGGATGGAAGGGGACAACGAGGATAATGAAGTC
CCTGAGGTTACCAGAAGTCGCAGTCCAGGCCCCCCACAAGTGGATGGGAC
ACCCACCATGTCCCTCGAGAGACCCCCCAGGGTGCCTCCGAGAGCTGCCT
CACAGAGGCCTCCGACCAGGGAGACCTTCCATCCTCCTCCACCTGTTCCA
CCCAGAGGACGCTGCCCAACTTTCTTGTACAAAGTGGTGGTACCTCGAAG
TTCCTATTCTCTACTTAGTATAGGAACTTCCATCCTTGGAGCTCCTTCAG
GAGGCGGTGCTACTGCTGGCGCTGGTGGAGCCGGTGGACCTGCGGGGTTA
ATTTACCCATACGATGTTCCTGACTATGCGGGCTATCCCTATGACGTCCC
GGACTATGCAGGATCCTATCCATATGACGTTCCAGATTACGCTTGA
MRFFTSVACYGSCLFASELLIRCKDWLKGRPALFTALLACVLYLCEWTGA
KHVPGSSYVEMLQASTSNPIPGDGFSRATKDSMIRKFLEGNSMGMTNLER
DQCHLGQEEDVYHTVDDDEAFSVDLASRPPVPVPRPETTAPGAHQLPDNE
PYIFKVFAEKSQERPGNFYVSSESIRKGPPVRPWRDRPQSSIYDPFAGMK
TPGQRQLITLQEQVKLGIVNVDEAVLHFKEWQLNQKKRSESFRFQQENLK
RLRDSITRRQREKQKSGKQTDLEITVPIRHSQHLPAKVEFGVYESGPRKS
VIPPRTELRRGDWKTDSTSSTASSTSNRSSTRSLLSVSSGMEGDNEDNEV
PEVTRSRSPGPPQVDGTPTMSLERPPRVPPRAASQRPPTRETFHPPPPVP
PRGRCPTFLYKVVVPRSSYSLLSIGTSILGAPSGGGATAGAGGAGGPAGL
IYPYDVPDYAGYPYDVPDYAGSYPYDVPDYA*

Index