Stock Number Hs1474

Human Gene: ABHD12


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
ABHD12 abhydrolase domain containing 12 HGNC:15868 20p11.21 CG15111 2R

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03803 pGW-HA.attB ENST00000471287.5 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK33166206084866

Sequences

DNA sequence (1446 bp) Protein sequence (482 aa)
ATGAGGAAGCGGACCGAGCCCGTCGCCTTGGAGCATGAGCGCTGCGCCGC
CGCGGGCTCGTCCTCCTCCGGCTCGGCCGCCGCGGCGCTGGACGCCGACT
GCCGCCTGAAGCAGAACCTACGCCTGACGGGCCCGGCGGCGGCTGAGCCG
CGCTGCGCAGCCGACGCGGGAATGAAGCGGGCGCTGGGCAGGCGAAAGGG
CGTGTGGTTGCGCCTGAGGAAGATACTTTTCTGTGTTTTGGGGTTGTACA
TTGCCATTCCATTTCTCATCAAACTATGTCCTGGAATACAGGCCAAACTG
ATTTTCTTGAATTTCGTAAGAGTTCCCTATTTCATTGATTTGAAAAAACC
ACAGGATCAAGGTTTGAATCACACGTGTAACTACTACCTGCAGCCAGAGG
AAGACGTGACCATTGGAGTCTGGCACACCGTCCCTGCAGTCTGGTGGAAG
AACGCCCAAGGCAAAGACCAGATGTGGTATGAGGATGCCTTGGCTTCCAG
CCACCCTATCATTCTGTACCTGCATGGGAACGCAGGTACCAGAGGAGGCG
ACCACCGCGTGGAGCTTTACAAGGTGCTGAGTTCCCTTGGTTACCATGTG
GTCACCTTTGACTACAGAGGTTGGGGTGACTCAGTGGGAACGCCATCTGA
GCGGGGCATGACCTATGACGCACTCCACGTTTTTGACTGGATCAAAGCAA
GAAGTGGTGACAACCCCGTGTACATCTGGGGCCACTCTCTGGGCACTGGC
GTGGCGACAAATCTGGTGCGGCGCCTCTGTGAGCGAGAGACGCCTCCAGA
TGCCCTTATATTGGAATCTCCATTCACTAATATCCGTGAAGAAGCTAAGA
GCCATCCATTTTCAGTGATATATCGATACTTCCCTGGGTTTGACTGGTTC
TTCCTTGATCCTATTACAAGTAGTGGAATTAAATTTGCAAATGATGAAAA
CGTGAAGCACATCTCCTGTCCCCTGCTCATCCTGCACGCTGAGGACGACC
CGGTGGTGCCCTTCCAGCTTGGCAGAAAGCTCTATAGCATCGCCGCACCA
GCTCGAAGCTTCCGAGATTTCAAAGTTCAGTTTGTGCCCTTTCATTCAGA
CCTTGGCTACAGGCACAAATACATTTACAAGAGCCCTGAGCTGCCACGGA
TACTGAGACCTCAGCAGGGCCCAGGTTCCAGCCCAGATCCCAGCATGTGG
TCAGAGCTGGTGTGCCCAACTTTCTTGTACAAAGTGGTGGTACCTCGAAG
TTCCTATTCTCTACTTAGTATAGGAACTTCCATCCTTGGAGCTCCTTCAG
GAGGCGGTGCTACTGCTGGCGCTGGTGGAGCCGGTGGACCTGCGGGGTTA
ATTTACCCATACGATGTTCCTGACTATGCGGGCTATCCCTATGACGTCCC
GGACTATGCAGGATCCTATCCATATGACGTTCCAGATTACGCTTGA
MRKRTEPVALEHERCAAAGSSSSGSAAAALDADCRLKQNLRLTGPAAAEP
RCAADAGMKRALGRRKGVWLRLRKILFCVLGLYIAIPFLIKLCPGIQAKL
IFLNFVRVPYFIDLKKPQDQGLNHTCNYYLQPEEDVTIGVWHTVPAVWWK
NAQGKDQMWYEDALASSHPIILYLHGNAGTRGGDHRVELYKVLSSLGYHV
VTFDYRGWGDSVGTPSERGMTYDALHVFDWIKARSGDNPVYIWGHSLGTG
VATNLVRRLCERETPPDALILESPFTNIREEAKSHPFSVIYRYFPGFDWF
FLDPITSSGIKFANDENVKHISCPLLILHAEDDPVVPFQLGRKLYSIAAP
ARSFRDFKVQFVPFHSDLGYRHKYIYKSPELPRILRPQQGPGSSPDPSMW
SELVCPTFLYKVVVPRSSYSLLSIGTSILGAPSGGGATAGAGGAGGPAGL
IYPYDVPDYAGYPYDVPDYAGSYPYDVPDYA*

Index