Stock Number Hs1473

Human Gene: GPRC5B


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
GPRC5B G protein-coupled receptor class C group 5 member B HGNC:13308 16p12.3 boss 3R

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03802 pGW-HA.attB ENST00000570142.5 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK37166205984865

Sequences

DNA sequence (1443 bp) Protein sequence (481 aa)
ATGTTCGTGGCATCAGAGAGAAAGATGAGAGCTCACCAGGTGCTCACCTT
CCTCCTGCTCTTCGTGATCACCTCGGTGGCCTCTGAAAACGCCAGCACAT
CCCGAGGCTGTGGGCTGGACCTCCTCCCTCAGTACGTGTCCCTGTGCGAC
CTGGACGCCATCTGGGGCATTGTGGTGGAGGCGGTGGCCGGGGCGGGCGC
CCTGATCACACTGCTCCTGATGCTCATCCTCCTGGTGCGGCTGCCCTTCA
TCAAGGAGAAGGAGAAGAAGAGCCCTGTGGGCCTCCACTTTCTGTTCCTC
CTGGGGACCCTGGGCCTCTTTGGGCTGACGTTTGCCTTCATCATCCAGGA
GGACGAGACCATCTGCTCTGTCCGCCGCTTCCTCTGGGGCGTCCTCTTTG
CGCTCTGCTTCTCCTGCCTGCTGAGCCAGGCATGGCGCGTGCGGAGGCTG
GTGCGGCATGGCACGGGCCCCGCGGGCTGGCAGCTGGTGGGCCTGGCGCT
GTGCCTGATGCTGGTGCAAGTCATCATCGCTGTGGAGTGGCTGGTGCTCA
CCGTGCTGCGTGACACAAGGCCAGCCTGCGCCTACGAGCCCATGGACTTT
GTGATGGCCCTCATCTACGACATGGTACTGCTTGTGGTCACCCTGGGGCT
GGCCCTCTTCACTCTGTGCGGCAAGTTCAAGAGGTGGAAGCTGAACGGGG
CCTTCCTCCTCATCACAGCCTTCCTCTCTGTGCTCATCTGGGTGGCCTGG
ATGACCATGTACCTCTTCGGCAATGTCAAGCTGCAGCAGGGGGATGCCTG
GAACGACCCCACCTTGGCCATCACGCTGGCGGCCAGCGGCTGGGTCTTCG
TCATCTTCCACGCCATCCCTGAGATCCACTGCACCCTTCTGCCAGCCCTG
CAGGAGAACACGCCCAACTACTTCGACACGTCGCAGCCCAGGATGCGGGA
GACGGCCTTCGAGGAGGACGTGCAGCTGCCGCGGGCCTATATGGAGAACA
AGGCCTTCTCCATGGATGAACACAATGCAGCTCTCCGAACAGCAGGATTT
CCCAACGGCAGCTTGGGAAAAAGACCCAGTGGCAGCTTGGGGAAAAGACC
CAGCGCTCCGTTTAGAAGCAACGTGTATCAGCCAACTGAGATGGCCGTCG
TGCTCAACGGTGGGACCATCCCAACTGCTCCGCCAAGTCACACAGGAAGA
CACCTTTGGTGCCCAACTTTCTTGTACAAAGTGGTGGTACCTCGAAGTTC
CTATTCTCTACTTAGTATAGGAACTTCCATCCTTGGAGCTCCTTCAGGAG
GCGGTGCTACTGCTGGCGCTGGTGGAGCCGGTGGACCTGCGGGGTTAATT
TACCCATACGATGTTCCTGACTATGCGGGCTATCCCTATGACGTCCCGGA
CTATGCAGGATCCTATCCATATGACGTTCCAGATTACGCTTGA
MFVASERKMRAHQVLTFLLLFVITSVASENASTSRGCGLDLLPQYVSLCD
LDAIWGIVVEAVAGAGALITLLLMLILLVRLPFIKEKEKKSPVGLHFLFL
LGTLGLFGLTFAFIIQEDETICSVRRFLWGVLFALCFSCLLSQAWRVRRL
VRHGTGPAGWQLVGLALCLMLVQVIIAVEWLVLTVLRDTRPACAYEPMDF
VMALIYDMVLLVVTLGLALFTLCGKFKRWKLNGAFLLITAFLSVLIWVAW
MTMYLFGNVKLQQGDAWNDPTLAITLAASGWVFVIFHAIPEIHCTLLPAL
QENTPNYFDTSQPRMRETAFEEDVQLPRAYMENKAFSMDEHNAALRTAGF
PNGSLGKRPSGSLGKRPSAPFRSNVYQPTEMAVVLNGGTIPTAPPSHTGR
HLWCPTFLYKVVVPRSSYSLLSIGTSILGAPSGGGATAGAGGAGGPAGLI
YPYDVPDYAGYPYDVPDYAGSYPYDVPDYA*

Index