Stock Number Hs1472

Human Gene: LHX1


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
LHX1 LIM homeobox 1 HGNC:6593 17q12 Lim1 X

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03907 pGW-HA.attB ENST00000614239.1 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK37166205884864

Sequences

DNA sequence (1455 bp) Protein sequence (485 aa)
ATGGTTCACTGTGCCGGCTGCAAAAGGCCCATCCTGGACCGCTTTCTCTT
GAACGTGCTGGACAGGGCCTGGCACGTCAAGTGCGTCCAGTGCTGTGAAT
GTAAATGCAACCTGACCGAGAAGTGCTTCTCCAGGGAAGGCAAACTCTAC
TGCAAGAACGACTTCTTCCGGTGTTTCGGTACCAAATGCGCAGGCTGCGC
TCAGGGCATCTCCCCTAGCGACCTGGTGCGGAGAGCGCGGAGCAAAGTGT
TTCACCTGAACTGCTTCACCTGCATGATGTGTAACAAGCAGCTCTCCACT
GGCGAGGAACTCTACATCATCGACGAGAATAAGTTCGTCTGCAAAGAGGA
TTACCTAAGTAACAGCAGTGTTGCCAAAGAGAACAGCCTTCACTCGGCCA
CCACGGGCAGTGACCCCAGTTTGTCTCCGGATTCCCAAGACCCGTCGCAG
GACGACGCCAAGGACTCGGAGAGCGCCAACGTGTCGGACAAGGAAGCGGG
TAGCAACGAGAATGACGACCAGAACCTGGGCGCCAAGCGGCGGGGACCGC
GCACCACCATCAAAGCCAAGCAGCTGGAGACGCTGAAGGCCGCCTTCGCT
GCTACACCCAAGCCCACCCGCCACATCCGCGAGCAGCTGGCGCAGGAGAC
CGGCCTCAACATGCGCGTCATTCAGGTCTGGTTCCAGAACCGGCGCTCCA
AGGAGCGGAGGATGAAGCAGCTGAGCGCCCTGGGCGCCCGGCGCCACGCC
TTCTTCCGCAGTCCGCGCCGGATGCGGCCGCTGGTGGACCGCCTGGAGCC
GGGCGAGCTCATCCCCAATGGTCCCTTCTCCTTCTACGGAGATTACCAGA
GCGAGTACTACGGGCCCGGGGGCAACTACGACTTCTTCCCGCAAGGCCCC
CCGTCCTCGCAGGCCCAGACACCAGTGGACCTACCCTTCGTGCCGTCATC
TGGGCCGTCCGGGACGCCCCTGGGTGGCCTGGAGCACCCGCTGCCGGGCC
ACCACCCGTCGAGCGAGGCGCAGCGGTTTACCGACATCCTGGCGCACCCA
CCCGGGGACTCGCCCAGCCCCGAGCCCAGCCTGCCCGGGCCTCTGCACTC
CATGTCGGCCGAGGTCTTCGGACCCAGCCCGCCCTTCTCGTCGCTGTCGG
TCAACGGTGGGGCGAGCTACGGAAACCACCTGTCCCACCCCCCCGAAATG
AACGAGGCGGCCGTGTGGTTGGACCCAGCTTTCTTGTACAAAGTGGTGGT
ACCTCGAAGTTCCTATTCTCTACTTAGTATAGGAACTTCCATCCTTGGAG
CTCCTTCAGGAGGCGGTGCTACTGCTGGCGCTGGTGGAGCCGGTGGACCT
GCGGGGTTAATTTACCCATACGATGTTCCTGACTATGCGGGCTATCCCTA
TGACGTCCCGGACTATGCAGGATCCTATCCATATGACGTTCCAGATTACG
CTTGA
MVHCAGCKRPILDRFLLNVLDRAWHVKCVQCCECKCNLTEKCFSREGKLY
CKNDFFRCFGTKCAGCAQGISPSDLVRRARSKVFHLNCFTCMMCNKQLST
GEELYIIDENKFVCKEDYLSNSSVAKENSLHSATTGSDPSLSPDSQDPSQ
DDAKDSESANVSDKEAGSNENDDQNLGAKRRGPRTTIKAKQLETLKAAFA
ATPKPTRHIREQLAQETGLNMRVIQVWFQNRRSKERRMKQLSALGARRHA
FFRSPRRMRPLVDRLEPGELIPNGPFSFYGDYQSEYYGPGGNYDFFPQGP
PSSQAQTPVDLPFVPSSGPSGTPLGGLEHPLPGHHPSSEAQRFTDILAHP
PGDSPSPEPSLPGPLHSMSAEVFGPSPPFSSLSVNGGASYGNHLSHPPEM
NEAAVWLDPAFLYKVVVPRSSYSLLSIGTSILGAPSGGGATAGAGGAGGP
AGLIYPYDVPDYAGYPYDVPDYAGSYPYDVPDYA*

Index