Stock Number Hs1471

Human Gene: PACSIN3


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
PACSIN3 protein kinase C and casein kinase substrate in neurons 3 HGNC:8572 11p11.2 Synd 3R

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03893 pGW-HA.attB ENST00000298838.10 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK37166205784863

Sequences

DNA sequence (1506 bp) Protein sequence (502 aa)
ATGGCTCCAGAAGAGGACGCTGGAGGGGAGGCCTTAGGGGGCAGTTTCTG
GGAGGCTGGCAACTACAGGCGCACGGTACAGCGGGTGGAGGACGGGCACC
GGCTGTGCGGGGACCTGGTCAGCTGCTTCCAGGAGCGCGCCCGCATCGAG
AAGGCTTATGCCCAGCAGTTGGCTGACTGGGCCCGAAAGTGGAGGGGGAC
CGTGGAGAAGGGCCCCCAGTATGGCACACTGGAGAAGGCCTGGCATGCCT
TTTTCACGGCGGCTGAGCGGCTGAGCGCGCTGCACCTGGAGGTGCGGGAG
AAGCTGCAAGGGCAGGACAGTGAGCGGGTGCGCGCCTGGCAGCGGGGGGC
TTTCCACCGGCCTGTGCTGGGCGGCTTCCGCGAGAGCCGGGCGGCCGAGG
ACGGCTTCCGCAAGGCCCAGAAGCCCTGGCTGAAGAGGCTGAAGGAGGTT
GAGGCTTCCAAGAAAAGCTACCACGCAGCCCGGAAGGATGAGAAGACCGC
CCAGACGAGGGAGAGCCACGCAAAGGCAGACAGCGCCGTCTCCCAGGAGC
AGCTGCGCAAACTGCAGGAACGGGTGGAACGCTGTGCCAAGGAGGCCGAG
AAGACAAAAGCTCAGTATGAGCAGACGCTGGCAGAGCTGCATCGCTACAC
TCCACGCTACATGGAGGACATGGAACAGGCCTTTGAGACCTGCCAGGCCG
CCGAGCGCCAGCGGCTTCTTTTCTTCAAGGATATGCTGCTCACCTTACAC
CAGCACCTGGACCTTTCCAGCAGTGAGAAGTTCCATGAACTCCACCGTGA
CTTGCACCAGGGCATTGAGGCAGCCAGTGACGAAGAGGATCTGCGCTGGT
GGCGCAGCACCCACGGGCCAGGCATGGCCATGAACTGGCCACAGTTCGAG
GAGTGGTCCTTGGACACACAGAGGACAATCAGCCGGAAAGAGAAGGGTGG
CCGGAGCCCTGATGAGGTTACCCTGACCAGCATTGTGCCTACAAGAGATG
GCACCGCACCCCCACCCCAGTCCCCGGGGTCCCCAGGCACGGGGCAGGAT
GAGGAGTGGTCAGATGAAGAGAGTCCCCGGAAGGCTGCCACCGGGGTTCG
GGTGAGGGCACTCTATGACTACGCTGGCCAGGAAGCTGATGAGCTGAGCT
TCCGAGCAGGGGAGGAGCTGCTGAAGATGAGTGAGGAGGACGAGCAGGGC
TGGTGCCAAGGCCAGTTGCAGAGTGGCCGCATTGGCCTGTACCCTGCCAA
CTACGTGGAGTGTGTGGGCGCCTGCCCAACTTTCTTGTACAAAGTGGTGG
TACCTCGAAGTTCCTATTCTCTACTTAGTATAGGAACTTCCATCCTTGGA
GCTCCTTCAGGAGGCGGTGCTACTGCTGGCGCTGGTGGAGCCGGTGGACC
TGCGGGGTTAATTTACCCATACGATGTTCCTGACTATGCGGGCTATCCCT
ATGACGTCCCGGACTATGCAGGATCCTATCCATATGACGTTCCAGATTAC
GCTTGA
MAPEEDAGGEALGGSFWEAGNYRRTVQRVEDGHRLCGDLVSCFQERARIE
KAYAQQLADWARKWRGTVEKGPQYGTLEKAWHAFFTAAERLSALHLEVRE
KLQGQDSERVRAWQRGAFHRPVLGGFRESRAAEDGFRKAQKPWLKRLKEV
EASKKSYHAARKDEKTAQTRESHAKADSAVSQEQLRKLQERVERCAKEAE
KTKAQYEQTLAELHRYTPRYMEDMEQAFETCQAAERQRLLFFKDMLLTLH
QHLDLSSSEKFHELHRDLHQGIEAASDEEDLRWWRSTHGPGMAMNWPQFE
EWSLDTQRTISRKEKGGRSPDEVTLTSIVPTRDGTAPPPQSPGSPGTGQD
EEWSDEESPRKAATGVRVRALYDYAGQEADELSFRAGEELLKMSEEDEQG
WCQGQLQSGRIGLYPANYVECVGACPTFLYKVVVPRSSYSLLSIGTSILG
APSGGGATAGAGGAGGPAGLIYPYDVPDYAGYPYDVPDYAGSYPYDVPDY
A*

Index