Stock Number Hs1470

Human Gene: CSNK1G1


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
CSNK1G1 casein kinase 1 gamma 1 HGNC:2454 15q22.31 gish 3R

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03887 pGW-HA.attB ENST00000635514.1 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK37166205684862

Sequences

DNA sequence (1500 bp) Protein sequence (500 aa)
ATGGACCATCCTAGTAGGGAAAAGGATGAAAGACAACGGACAACTAAACC
CATGGCACAAAGGAGTGCACACTGCTCTCGACCATCTGGCTCCTCATCGT
CCTCTGGGGTTCTTATGGTGGGACCCAACTTCAGGGTTGGCAAGAAGATA
GGATGTGGGAACTTCGGAGAGCTCAGATTAGGTAAAAATCTCTACACCAA
TGAATATGTAGCAATCAAACTGGAACCAATAAAATCACGTGCTCCACAGC
TTCATTTAGAGTACAGATTTTATAAACAGCTTGGCAGTGCAGGTGAAGGT
CTCCCACAGGTGTATTACTTTGGACCATGTGGGAAATATAATGCCATGGT
GCTGGAGCTCCTTGGCCCTAGCTTGGAGGACTTGTTTGACCTCTGTGACC
GAACATTTACTTTGAAGACGGTGTTAATGATAGCCATCCAGCTGCTTTCT
CGAATGGAATACGTGCACTCAAAGAACCTCATTTACCGAGATGTCAAGCC
AGAGAACTTCCTGATTGGTCGACAAGGCAATAAGAAAGAGCATGTTATAC
ACATTATAGACTTTGGACTGGCCAAGGAATACATTGACCCCGAAACCAAA
AAACACATACCTTATAGGGAACACAAAAGTTTAACTGGAACTGCAAGATA
TATGTCTATCAACACGCATCTTGGCAAAGAGCAAAGCCGGAGAGATGATT
TGGAAGCCCTAGGCCATATGTTCATGTATTTCCTTCGAGGCAGCCTCCCC
TGGCAAGGACTCAAGGCTGACACATTAAAAGAGAGATATCAAAAAATTGG
TGACACCAAAAGGAATACTCCCATTGAAGCTCTCTGTGAGAACTTTCCAG
AGGAGATGGCAACCTACCTTCGATATGTCAGGCGACTGGACTTCTTTGAA
AAACCTGATTATGAGTATTTACGGACCCTCTTCACAGACCTCTTTGAAAA
GAAAGGCTACACCTTTGACTATGCCTATGATTGGGTTGGGAGACCTATTC
CTACTCCAGTAGGGTCAGTTCACGTAGATTCTGGTGCATCTGCAATAACT
CGAGAAAGCCACACACATAGGGATCGGCCATCACAACAGCAGCCTCTTCG
AAATCAGGTGGTTAGCTCAACCAATGGAGAGCTGAATGTTGATGATCCCA
CGGGAGCCCACTCCAATGCACCAATCACAGCTCATGCCGAGGTGGAGGTA
GTGGAGGAAGCTAAGTGCTGCTGTTTCTTTAAGAGGAAAAGGAAGAAGAC
TGCTCAGCGCCACAAGTTGCCAACTTTCTTGTACAAAGTGGTGGTACCTC
GAAGTTCCTATTCTCTACTTAGTATAGGAACTTCCATCCTTGGAGCTCCT
TCAGGAGGCGGTGCTACTGCTGGCGCTGGTGGAGCCGGTGGACCTGCGGG
GTTAATTTACCCATACGATGTTCCTGACTATGCGGGCTATCCCTATGACG
TCCCGGACTATGCAGGATCCTATCCATATGACGTTCCAGATTACGCTTGA
MDHPSREKDERQRTTKPMAQRSAHCSRPSGSSSSSGVLMVGPNFRVGKKI
GCGNFGELRLGKNLYTNEYVAIKLEPIKSRAPQLHLEYRFYKQLGSAGEG
LPQVYYFGPCGKYNAMVLELLGPSLEDLFDLCDRTFTLKTVLMIAIQLLS
RMEYVHSKNLIYRDVKPENFLIGRQGNKKEHVIHIIDFGLAKEYIDPETK
KHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLP
WQGLKADTLKERYQKIGDTKRNTPIEALCENFPEEMATYLRYVRRLDFFE
KPDYEYLRTLFTDLFEKKGYTFDYAYDWVGRPIPTPVGSVHVDSGASAIT
RESHTHRDRPSQQQPLRNQVVSSTNGELNVDDPTGAHSNAPITAHAEVEV
VEEAKCCCFFKRKRKKTAQRHKLPTFLYKVVVPRSSYSLLSIGTSILGAP
SGGGATAGAGGAGGPAGLIYPYDVPDYAGYPYDVPDYAGSYPYDVPDYA*

Index