Stock Number Hs1469

Human Gene: SYT1


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
SYT1 synaptotagmin 1 HGNC:11509 12q21.2 Syt1 2L

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03886 pGW-HA.attB ENST00000446242.3 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK33166205584861

Sequences

DNA sequence (1500 bp) Protein sequence (500 aa)
ATGGTGAGCGAGAGTCACCATGAGGCCCTGGCAGCCCCGCCTGTCACCAC
TGTCGCGACTGTTCTGCCAAGCAATGCCACAGAGCCAGCCAGTCCTGGAG
AAGGAAAGGAAGATGCATTTTCTAAGCTGAAGGAGAAGTTTATGAATGAG
TTGCATAAAATTCCATTGCCACCGTGGGCCTTAATTGCAATAGCCATAGT
CGCAGTCCTTTTAGTCCTGACCTGCTGCTTTTGTATCTGTAAGAAATGTT
TGTTCAAAAAGAAAAACAAGAAGAAGGGAAAGGAAAAAGGAGGGAAGAAT
GCCATTAACATGAAAGATGTAAAAGACTTAGGGAAGACGATGAAAGATCA
GGCCCTCAAGGATGATGATGCTGAAACTGGATTGACAGATGGAGAAGAAA
AAGAAGAACCCAAAGAAGAGGAGAAACTGGGAAAACTTCAGTATTCACTG
GATTATGATTTCCAAAATAACCAGCTGCTGGTAGGGATCATTCAGGCTGC
CGAACTGCCCGCCTTGGACATGGGGGGCACATCTGATCCTTACGTGAAAG
TGTTTCTGCTACCTGATAAGAAGAAGAAATTTGAGACAAAAGTCCACCGA
AAAACCCTTAATCCTGTCTTCAATGAGCAATTTACTTTCAAGGTACCATA
CTCGGAATTGGGTGGCAAAACCCTAGTGATGGCTGTATATGATTTTGATC
GTTTCTCTAAGCATGACATCATTGGAGAATTTAAAGTCCCTATGAACACA
GTGGATTTTGGCCATGTAACTGAGGAATGGCGTGACCTGCAAAGTGCTGA
GAAGGAAGAGCAAGAGAAATTGGGTGATATCTGCTTCTCCCTTCGCTACG
TACCTACTGCTGGTAAGCTGACTGTTGTCATTCTGGAGGCAAAGAACCTG
AAGAAGATGGATGTGGGTGGCTTATCCGATCCTTATGTGAAGATTCATCT
GATGCAGAATGGTAAGAGGCTGAAGAAGAAAAAGACAACAATTAAAAAGA
ACACACTTAACCCCTACTACAATGAGTCATTCAGCTTTGAAGTACCTTTT
GAACAAATCCAGAAAGTGCAGGTGGTGGTAACTGTTTTGGACTATGACAA
GATTGGCAAGAACGATGCCATCGGCAAAGTCTTTGTGGGCTACAACAGCA
CCGGCGCGGAGCTGCGACACTGGTCAGACATGCTGGCCAACCCCAGGCGA
CCTATTGCCCAGTGGCACACCCTGCAGGTAGAGGAGGAAGTTGATGCCAT
GCTGGCCGTCAAGAAGTACCCAACTTTCTTGTACAAAGTGGTGGTACCTC
GAAGTTCCTATTCTCTACTTAGTATAGGAACTTCCATCCTTGGAGCTCCT
TCAGGAGGCGGTGCTACTGCTGGCGCTGGTGGAGCCGGTGGACCTGCGGG
GTTAATTTACCCATACGATGTTCCTGACTATGCGGGCTATCCCTATGACG
TCCCGGACTATGCAGGATCCTATCCATATGACGTTCCAGATTACGCTTGA
MVSESHHEALAAPPVTTVATVLPSNATEPASPGEGKEDAFSKLKEKFMNE
LHKIPLPPWALIAIAIVAVLLVLTCCFCICKKCLFKKKNKKKGKEKGGKN
AINMKDVKDLGKTMKDQALKDDDAETGLTDGEEKEEPKEEEKLGKLQYSL
DYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHR
KTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNT
VDFGHVTEEWRDLQSAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNL
KKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPF
EQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRR
PIAQWHTLQVEEEVDAMLAVKKYPTFLYKVVVPRSSYSLLSIGTSILGAP
SGGGATAGAGGAGGPAGLIYPYDVPDYAGYPYDVPDYAGSYPYDVPDYA*

Index