Stock Number Hs1468

Human Gene: WDFY2


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
WDFY2 WD repeat and FYVE domain containing 2 HGNC:20482 13q14.3 Wdfy2 2L

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03788 pGW-HA.attB ENST00000298125.6 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK33166205484860

Sequences

DNA sequence (1434 bp) Protein sequence (478 aa)
ATGGCGGCGGAGATCCAGCCCAAGCCTCTGACCCGCAAGCCGATCCTGCT
GCAGCGGATGGAGGGGTCCCAGGAGGTGGTGAATATGGCCGTGATCGTGC
CCAAAGAGGAGGGCGTCATCAGCGTCTCCGAGGACAGGACAGTTCGTGTT
TGGTTAAAGAGAGACAGTGGACAGTATTGGCCAAGCGTATACCATGCAAT
GCCTTCTCCATGTTCATGCATGTCTTTTAACCCGGAAACAAGAAGACTGT
CCATAGGTCTAGACAATGGTACAATCTCAGAGTTTATATTGTCAGAAGAT
TATAACAAGATGACTCCTGTGAAAAACTATCAAGCGCATCAGAGCAGAGT
GACGATGATCCTGTTTGTCCTGGAGCTGGAGTGGGTGCTGAGCACAGGAC
AGGACAAGCAATTTGCCTGGCACTGCTCTGAGAGTGGGCAGCGCCTGGGA
GGTTATCGGACCAGTGCTGTGGCCTCAGGCCTGCAATTTGATGTTGAAAC
CCGGCATGTGTTTATCGGTGACCACTCAGGCCAAGTAACAATCCTCAAAC
TGGAGCAAGAAAACTGCACCCTGGTCACAACATTCAGAGGACACACAGGT
GGGGTGACCGCTCTCTGTTGGGACCCAGTCCAGCGGGTGTTGTTCTCAGG
CAGTTCAGATCACTCTGTCATCATGTGGGACATCGGTGGGAGAAAAGGAA
CAGCCATCGAGCTCCAAGGACACAACGACAGAGTCCAGGCCCTCTCCTAT
GCACAGCACACGCGACAATTGATCTCCTGTGGCGGTGATGGTGGGATTGT
CGTCTGGAACATGGACGTGGAGAGGCAGGAGACCCCTGAATGGTTGGACA
GTGATTCCTGCCAAAAGTGTGATCAGCCTTTCTTCTGGAACTTCAAGCAA
ATGTGGGACAGTAAGAAAATTGGTCTAAGACAGCACCACTGCCGCAAGTG
TGGGAAGGCCGTCTGTGGCAAGTGCAGCTCCAAGCGCTCCTCCATCCCCC
TGATGGGCTTCGAGTTTGAAGTGAGGGTCTGTGACAGCTGCCACGAGGCC
ATCACAGATGAAGAACGTGCACCCACAGCCACCTTCCATGACAGTAAACA
TAACATTGTGCATGTGCATTTCGATGCAACCAGAGGATGGTTACTGACTT
CTGGAACTGACAAGGTTATTAAGTTGTGGGATATGACCCCAGTCGTGTCT
TGCCCAACTTTCTTGTACAAAGTGGTGGTACCTCGAAGTTCCTATTCTCT
ACTTAGTATAGGAACTTCCATCCTTGGAGCTCCTTCAGGAGGCGGTGCTA
CTGCTGGCGCTGGTGGAGCCGGTGGACCTGCGGGGTTAATTTACCCATAC
GATGTTCCTGACTATGCGGGCTATCCCTATGACGTCCCGGACTATGCAGG
ATCCTATCCATATGACGTTCCAGATTACGCTTGA
MAAEIQPKPLTRKPILLQRMEGSQEVVNMAVIVPKEEGVISVSEDRTVRV
WLKRDSGQYWPSVYHAMPSPCSCMSFNPETRRLSIGLDNGTISEFILSED
YNKMTPVKNYQAHQSRVTMILFVLELEWVLSTGQDKQFAWHCSESGQRLG
GYRTSAVASGLQFDVETRHVFIGDHSGQVTILKLEQENCTLVTTFRGHTG
GVTALCWDPVQRVLFSGSSDHSVIMWDIGGRKGTAIELQGHNDRVQALSY
AQHTRQLISCGGDGGIVVWNMDVERQETPEWLDSDSCQKCDQPFFWNFKQ
MWDSKKIGLRQHHCRKCGKAVCGKCSSKRSSIPLMGFEFEVRVCDSCHEA
ITDEERAPTATFHDSKHNIVHVHFDATRGWLLTSGTDKVIKLWDMTPVVS
CPTFLYKVVVPRSSYSLLSIGTSILGAPSGGGATAGAGGAGGPAGLIYPY
DVPDYAGYPYDVPDYAGSYPYDVPDYA*

Index