Stock Number Hs1467

Human Gene: DOC2A


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
DOC2A double C2 domain alpha HGNC:2985 16p11.2 Rph X

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03786 pGW-HA.attB ENST00000563125.5 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK37166205384859

Sequences

DNA sequence (1434 bp) Protein sequence (478 aa)
ATGAGGGGCCGCAGGGGCGATCGCATGACCATCAACATCCAGGAGCACAT
GGCCATCAACGTGTGCCCCGGGCCCATCCGGCCCATCCGCCAGATCTCTG
ACTACTTCCCCCGGGGACCAGGACCTGAAGGGGGCGGCGGGAGCGGCGGG
GAGGCCCCCGCCCATCTGGTCCCCCTGGCTCTGGCCCCCCCTGCAGCCCT
CCTTGGGGCCACCACGCCTGAGGATGGTGCGGAGGTGGACAGCTATGACT
CGGATGATGCCACCGCCCTAGGCACGCTGGAGTTTGACCTTCTCTACGAC
CGGGCCTCCTGCACTCTGCACTGTAGCATCCTCAGGGCCAAGGGCCTCAA
GCCCATGGATTTCAATGGCCTCGCCGACCCCTACGTCAAGCTGCACTTGC
TGCCTGGAGCCTGTAAGGCCAATAAGCTAAAAACGAAGACTCAGAGGAAC
ACACTGAATCCCGTGTGGAATGAGGACCTGACTTACAGCGGGATCACAGA
TGACGACATCACGCACAAGGTGCTCAGGATCGCCGTCTGTGATGAGGACA
AGCTGAGTCACAATGAGTTTATTGGGGAGATCCGCGTGCCCCTCCGCCGC
CTCAAGCCTTCGCAGAAGAAGCATTTTAACATCTGCCTCGAGCGCCAAGT
CCCGCTGGCGTCCCCCTCTTCCATGTCAGCGGCGCTGAGGGGCATCTCCT
GTTATCTGAAGGAGTTGGAGCAGGCGGAGCAGGGGCAGGGGCTGCTGGAG
GAGCGTGGCCGCATCCTGCTGAGTCTCAGCTACAGCTCGCGGCGCCGGGG
ACTGCTGGTAGGCATCTTGCGCTGCGCCCATCTGGCTGCCATGGACGTCA
ACGGTTACTCGGACCCCTACGTCAAGACGTACCTGAGGCCCGATGTGGAC
AAGAAATCCAAGCATAAGACGTGTGTGAAGAAGAAGACTCTCAACCCAGA
ATTTAACGAGGAGTTTTTCTACGAGATAGAGCTCTCCACTCTGGCCACCA
AGACCCTGGAAGTCACCGTCTGGGACTATGACATTGGCAAATCCAATGAC
TTCATTGGTGGCGTGTCCCTGGGGCCAGGTGCCCGAGGCGAGGCTCGGAA
GCACTGGAGTGACTGCCTGCAGCAGCCGGACGCAGCCCTGGAGCGCTGGC
ACACCCTGACCAGTGAGCTGCCCCCTGCGGCCGGGGCTCTGTCCTCAGCC
TGCCCAACTTTCTTGTACAAAGTGGTGGTACCTCGAAGTTCCTATTCTCT
ACTTAGTATAGGAACTTCCATCCTTGGAGCTCCTTCAGGAGGCGGTGCTA
CTGCTGGCGCTGGTGGAGCCGGTGGACCTGCGGGGTTAATTTACCCATAC
GATGTTCCTGACTATGCGGGCTATCCCTATGACGTCCCGGACTATGCAGG
ATCCTATCCATATGACGTTCCAGATTACGCTTGA
MRGRRGDRMTINIQEHMAINVCPGPIRPIRQISDYFPRGPGPEGGGGSGG
EAPAHLVPLALAPPAALLGATTPEDGAEVDSYDSDDATALGTLEFDLLYD
RASCTLHCSILRAKGLKPMDFNGLADPYVKLHLLPGACKANKLKTKTQRN
TLNPVWNEDLTYSGITDDDITHKVLRIAVCDEDKLSHNEFIGEIRVPLRR
LKPSQKKHFNICLERQVPLASPSSMSAALRGISCYLKELEQAEQGQGLLE
ERGRILLSLSYSSRRRGLLVGILRCAHLAAMDVNGYSDPYVKTYLRPDVD
KKSKHKTCVKKKTLNPEFNEEFFYEIELSTLATKTLEVTVWDYDIGKSND
FIGGVSLGPGARGEARKHWSDCLQQPDAALERWHTLTSELPPAAGALSSA
CPTFLYKVVVPRSSYSLLSIGTSILGAPSGGGATAGAGGAGGPAGLIYPY
DVPDYAGYPYDVPDYAGSYPYDVPDYA*

Index