Stock Number Hs1466

Human Gene: POU2F2


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
POU2F2 POU class 2 homeobox 2 HGNC:9213 19q13.2 nub 2L

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03785 pGW-HA.attB ENST00000529067.5 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK33166205284858

Sequences

DNA sequence (1434 bp) Protein sequence (478 aa)
ATGGTTCACTCCAGCATGGGGGCTCCAGAAATAAGAATGTCTAAGCCCCT
GGAGGCCGAGAAGCAAGGTCTGGACTCCCCATCAGAGCACACAGACACCG
AAAGAAATGGACCAGACACTAATCATCAGAACCCCCAAAATAAGACCTCC
CCATTCTCCGTGTCCCCAACTGGCCCCAGTACAAAGATCAAGGCTGAAGA
CCCCAGTGGCGATTCAGCCCCAGCAGCACCCCTGCCCCCTCAGCCGGCCC
AGCCTCATCTGCCCCAGGCCCAACTCATGTTGACGGGCAGCCAGCTAGCT
GGGGACATACAGCAGCTCCTCCAGCTCCAGCAGCTGGTGCTTGTGCCAGG
CCACCACCTCCAGCCACCTGCTCAGTTCCTGCTACCGCAGGCCCAGCAGA
GCCAGCCAGGCCTGCTACCGACACCAAATCTATTCCAGCTACCTCAGCAA
ACCCAGGGAGCTCTTCTGACCTCCCAGCCCCGGGCCGGGCTTCCCACACA
GCCCCCCAAATGCTTGGAGCCACCATCCCACCCCGAGGAGCCCAGTGATC
TGGAGGAGCTGGAGCAATTCGCCCGCACCTTCAAGCAACGCCGCATCAAG
CTGGGCTTCACGCAGGGTGATGTGGGCCTGGCCATGGGCAAGCTCTACGG
CAACGACTTCAGCCAGACGACCATTTCCCGCTTCGAGGCCCTCAACCTGA
GCTTCAAGAACATGTGCAAACTCAAGCCCCTCCTGGAGAAGTGGCTCAAC
GATGCAGAGACTATGTCTGTGGACTCAAGCCTGCCCAGCCCCAACCAGCT
GAGCAGCCCCAGCCTGGGTTTCGACGGCCTGCCCGGCCGGAGACGCAAGA
AGAGGACCAGCATCGAGACAAACGTCCGCTTCGCCTTAGAGAAGAGTTTT
CTAGCGAACCAGAAGCCTACCTCAGAGGAGATCCTGCTGATCGCCGAGCA
GCTGCACATGGAGAAGGAAGTGATCCGCGTCTGGTTCTGCAACCGGCGCC
AGAAGGAGAAACGCATCAACCCCTGCAGTGCGGCCCCCATGCTGCCCAGC
CCAGGGAAGCCGGCCAGCTACAGCCCCCATATGGTCACACCCCAAGGGGG
CGCGGGGACCTTACCGTTGTCCCAAGCTTCCAGCAGTCTGAGCACAACAG
CACAAACCCCAGCCCTCAAGGCAGCCACTCGGCTATCGGCTTGTCAGGCC
TGCCCAACTTTCTTGTACAAAGTGGTGGTACCTCGAAGTTCCTATTCTCT
ACTTAGTATAGGAACTTCCATCCTTGGAGCTCCTTCAGGAGGCGGTGCTA
CTGCTGGCGCTGGTGGAGCCGGTGGACCTGCGGGGTTAATTTACCCATAC
GATGTTCCTGACTATGCGGGCTATCCCTATGACGTCCCGGACTATGCAGG
ATCCTATCCATATGACGTTCCAGATTACGCTTGA
MVHSSMGAPEIRMSKPLEAEKQGLDSPSEHTDTERNGPDTNHQNPQNKTS
PFSVSPTGPSTKIKAEDPSGDSAPAAPLPPQPAQPHLPQAQLMLTGSQLA
GDIQQLLQLQQLVLVPGHHLQPPAQFLLPQAQQSQPGLLPTPNLFQLPQQ
TQGALLTSQPRAGLPTQPPKCLEPPSHPEEPSDLEELEQFARTFKQRRIK
LGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMCKLKPLLEKWLN
DAETMSVDSSLPSPNQLSSPSLGFDGLPGRRRKKRTSIETNVRFALEKSF
LANQKPTSEEILLIAEQLHMEKEVIRVWFCNRRQKEKRINPCSAAPMLPS
PGKPASYSPHMVTPQGGAGTLPLSQASSSLSTTAQTPALKAATRLSACQA
CPTFLYKVVVPRSSYSLLSIGTSILGAPSGGGATAGAGGAGGPAGLIYPY
DVPDYAGYPYDVPDYAGSYPYDVPDYA*

Index