Stock Number Hs1465

Human Gene: HTR1B


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
HTR1B 5-hydroxytryptamine receptor 1B HGNC:5287 6q14.1 5-HT1B 2R

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03633 pGW-HA.attB ENST00000369947.4 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK33166205184857

Sequences

DNA sequence (1404 bp) Protein sequence (468 aa)
ATGGAGGAACCGGGTGCTCAGTGCGCTCCACCGCCGCCCGCGGGCTCCGA
GACCTGGGTTCCTCAAGCCAACTTATCCTCTGCTCCCTCCCAAAACTGCA
GCGCCAAGGACTACATTTACCAGGACTCCATCTCCCTACCCTGGAAAGTA
CTGCTGGTTATGCTATTGGCGCTCATCACCTTGGCCACCACGCTCTCCAA
TGCCTTTGTGATTGCCACAGTGTACCGGACCCGGAAACTGCACACCCCGG
CTAACTACCTGATCGCCTCTCTGGCGGTCACCGACCTGCTTGTGTCCATC
CTGGTGATGCCCATCAGCACCATGTACACTGTCACCGGCCGCTGGACACT
GGGCCAGGTGGTCTGTGACTTCTGGCTGTCGTCGGACATCACTTGTTGCA
CTGCCTCCATCCTGCACCTCTGTGTCATCGCCCTGGACCGCTACTGGGCC
ATCACGGACGCCGTGGAGTACTCAGCTAAAAGGACTCCCAAGAGGGCGGC
GGTCATGATCGCGCTGGTGTGGGTCTTCTCCATCTCTATCTCGCTGCCGC
CCTTCTTCTGGCGTCAGGCTAAGGCCGAAGAGGAGGTGTCGGAATGCGTG
GTGAACACCGACCACATCCTCTACACGGTCTACTCCACGGTGGGTGCTTT
CTACTTCCCCACCCTGCTCCTCATCGCCCTCTATGGCCGCATCTACGTAG
AAGCCCGCTCCCGGATTTTGAAACAGACGCCCAACAGGACCGGCAAGCGC
TTGACCCGAGCCCAGCTGATAACCGACTCCCCCGGGTCCACGTCCTCGGT
CACCTCTATTAACTCGCGGGTTCCCGACGTGCCCAGCGAATCCGGATCTC
CTGTGTATGTGAACCAAGTCAAAGTGCGAGTCTCCGACGCCCTGCTGGAA
AAGAAGAAACTCATGGCCGCTAGGGAGCGCAAAGCCACCAAGACCCTAGG
GATCATTTTGGGAGCCTTTATTGTGTGTTGGCTACCCTTCTTCATCATCT
CCCTAGTGATGCCTATCTGCAAAGATGCCTGCTGGTTCCACCTAGCCATC
TTTGACTTCTTCACATGGCTGGGCTATCTCAACTCCCTCATCAACCCCAT
AATCTATACCATGTCCAATGAGGACTTTAAACAAGCATTCCATAAACTGA
TACGTTTTAAGTGCACAAGTTTGCCAACTTTCTTGTACAAAGTGGTGGTA
CCTCGAAGTTCCTATTCTCTACTTAGTATAGGAACTTCCATCCTTGGAGC
TCCTTCAGGAGGCGGTGCTACTGCTGGCGCTGGTGGAGCCGGTGGACCTG
CGGGGTTAATTTACCCATACGATGTTCCTGACTATGCGGGCTATCCCTAT
GACGTCCCGGACTATGCAGGATCCTATCCATATGACGTTCCAGATTACGC
TTGA
MEEPGAQCAPPPPAGSETWVPQANLSSAPSQNCSAKDYIYQDSISLPWKV
LLVMLLALITLATTLSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSI
LVMPISTMYTVTGRWTLGQVVCDFWLSSDITCCTASILHLCVIALDRYWA
ITDAVEYSAKRTPKRAAVMIALVWVFSISISLPPFFWRQAKAEEEVSECV
VNTDHILYTVYSTVGAFYFPTLLLIALYGRIYVEARSRILKQTPNRTGKR
LTRAQLITDSPGSTSSVTSINSRVPDVPSESGSPVYVNQVKVRVSDALLE
KKKLMAARERKATKTLGIILGAFIVCWLPFFIISLVMPICKDACWFHLAI
FDFFTWLGYLNSLINPIIYTMSNEDFKQAFHKLIRFKCTSLPTFLYKVVV
PRSSYSLLSIGTSILGAPSGGGATAGAGGAGGPAGLIYPYDVPDYAGYPY
DVPDYAGSYPYDVPDYA*

Index