Stock Number Hs1464

Human Gene: WNT10B


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
WNT10B Wnt family member 10B HGNC:12775 12q13.12 Wnt10 2L

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03632 pGW-HA.attB ENST00000301061.8 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK33166205084856

Sequences

DNA sequence (1401 bp) Protein sequence (467 aa)
ATGCTGGAGGAGCCCCGGCCGCGGCCTCCGCCCTCGGGCCTCGCGGGTCT
CCTGTTCCTGGCGTTGTGCAGTCGGGCTCTAAGCAATGAGATTCTGGGCC
TGAAGTTGCCTGGCGAGCCGCCGCTGACGGCCAACACCGTGTGCTTGACG
CTGTCCGGCCTGAGCAAGCGGCAGCTAGGCCTGTGCCTGCGCAACCCCGA
CGTGACGGCGTCCGCGCTTCAGGGTCTGCACATCGCGGTCCACGAGTGTC
AGCACCAGCTGCGCGACCAGCGCTGGAACTGCTCCGCGCTTGAGGGCGGC
GGCCGCCTGCCGCACCACAGCGCCATCCTCAAGCGCGGTTTCCGAGAAAG
TGCTTTTTCCTTCTCCATGCTGGCTGCTGGGGTCATGCACGCAGTAGCCA
CGGCCTGCAGCCTGGGCAAGCTGGTGAGCTGTGGCTGTGGCTGGAAGGGC
AGTGGTGAGCAGGATCGGCTGAGGGCCAAACTGCTGCAGCTGCAGGCACT
GTCCCGAGGCAAGAGTTTCCCCCACTCTCTGCCCAGCCCTGGCCCTGGCT
CAAGCCCCAGCCCTGGCCCCCAGGACACATGGGAATGGGGTGGCTGTAAC
CATGACATGGACTTTGGAGAGAAGTTCTCTCGGGATTTCTTGGATTCCAG
GGAAGCTCCCCGGGACATCCAGGCACGAATGCGAATCCACAACAACAGGG
TGGGGCGCCAGGTGGTAACTGAAAACCTGAAGCGGAAATGCAAGTGTCAT
GGCACATCAGGCAGCTGCCAGTTCAAGACATGCTGGAGGGCGGCCCCAGA
GTTCCGGGCAGTGGGGGCGGCGTTGAGGGAGCGGCTGGGCCGGGCCATCT
TCATTGATACCCACAACCGCAATTCTGGAGCCTTCCAGCCCCGTCTGCGT
CCCCGTCGCCTCTCAGGAGAGCTGGTCTACTTTGAGAAGTCTCCTGACTT
CTGTGAGCGAGACCCCACTATGGGCTCCCCAGGGACAAGGGGCCGGGCCT
GCAACAAGACCAGCCGCCTGTTGGATGGCTGTGGCAGCCTGTGCTGTGGC
CGTGGGCATAACGTGCTCCGGCAGACACGAGTTGAGCGCTGCCATTGCCG
CTTCCACTGGTGCTGCTATGTGCTGTGTGATGAGTGCAAGGTTACAGAGT
GGGTGAATGTGTGTAAGTTGCCAACTTTCTTGTACAAAGTGGTGGTACCT
CGAAGTTCCTATTCTCTACTTAGTATAGGAACTTCCATCCTTGGAGCTCC
TTCAGGAGGCGGTGCTACTGCTGGCGCTGGTGGAGCCGGTGGACCTGCGG
GGTTAATTTACCCATACGATGTTCCTGACTATGCGGGCTATCCCTATGAC
GTCCCGGACTATGCAGGATCCTATCCATATGACGTTCCAGATTACGCTTG
A
MLEEPRPRPPPSGLAGLLFLALCSRALSNEILGLKLPGEPPLTANTVCLT
LSGLSKRQLGLCLRNPDVTASALQGLHIAVHECQHQLRDQRWNCSALEGG
GRLPHHSAILKRGFRESAFSFSMLAAGVMHAVATACSLGKLVSCGCGWKG
SGEQDRLRAKLLQLQALSRGKSFPHSLPSPGPGSSPSPGPQDTWEWGGCN
HDMDFGEKFSRDFLDSREAPRDIQARMRIHNNRVGRQVVTENLKRKCKCH
GTSGSCQFKTCWRAAPEFRAVGAALRERLGRAIFIDTHNRNSGAFQPRLR
PRRLSGELVYFEKSPDFCERDPTMGSPGTRGRACNKTSRLLDGCGSLCCG
RGHNVLRQTRVERCHCRFHWCCYVLCDECKVTEWVNVCKLPTFLYKVVVP
RSSYSLLSIGTSILGAPSGGGATAGAGGAGGPAGLIYPYDVPDYAGYPYD
VPDYAGSYPYDVPDYA*

Index