Stock Number Hs1463

Human Gene: RRM2


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
RRM2 ribonucleotide reductase regulatory subunit M2 HGNC:10452 2p25.1 RnrS 2R

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03631 pGW-HA.attB ENST00000641198.1 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK33166204984855

Sequences

DNA sequence (1401 bp) Protein sequence (467 aa)
ATGCTCTCCCTCCGTGTCCCGCTCGCGCCCATCACGGACCCGCAGCAGCT
GCAGCTCTCGCCGCTGAAGGGGCTCAGCTTGGTCGACAAGGAGAACACGC
CGCCGGCCCTGAGCGGGACCCGCGTCCTGGCCAGCAAGACCGCGAGGAGG
ATCTTCCAGGAGCCCACGGAGCCGAAAACTAAAGCAGCTGCCCCCGGCGT
GGAGGATGAGCCGCTGCTGAGAGAAAACCCCCGCCGCTTTGTCATCTTCC
CCATCGAGTACCATGATATCTGGCAGATGTATAAGAAGGCAGAGGCTTCC
TTTTGGACCGCCGAGGAGGTGGACCTCTCCAAGGACATTCAGCACTGGGA
ATCCCTGAAACCCGAGGAGAGATATTTTATATCCCATGTTCTGGCTTTCT
TTGCAGCAAGCGATGGCATAGTAAATGAAAACTTGGTGGAGCGATTTAGC
CAAGAAGTTCAGATTACAGAAGCCCGCTGTTTCTATGGCTTCCAAATTGC
CATGGAAAACATACATTCTGAAATGTATAGTCTTCTTATTGACACTTACA
TAAAAGATCCCAAAGAAAGGGAATTTCTCTTCAATGCCATTGAAACGATG
CCTTGTGTCAAGAAGAAGGCAGACTGGGCCTTGCGCTGGATTGGGGACAA
AGAGGCTACCTATGGTGAACGTGTTGTAGCCTTTGCTGCAGTGGAAGGCA
TTTTCTTTTCCGGTTCTTTTGCGTCGATATTCTGGCTCAAGAAACGAGGA
CTGATGCCTGGCCTCACATTTTCTAATGAACTTATTAGCAGAGATGAGGG
TTTACACTGTGATTTTGCTTGCCTGATGTTCAAACACCTGGTACACAAAC
CATCGGAGGAGAGAGTAAGAGAAATAATTATCAATGCTGTTCGGATAGAA
CAGGAGTTCCTCACTGAGGCCTTGCCTGTGAAGCTCATTGGGATGAATTG
CACTCTAATGAAGCAATACATTGAGTTTGTGGCAGACAGACTTATGCTGG
AACTGGGTTTTAGCAAGGTTTTCAGAGTAGAGAACCCATTTGACTTTATG
GAGAATATTTCACTGGAAGGAAAGACTAACTTCTTTGAGAAGAGAGTAGG
CGAGTATCAGAGGATGGGAGTGATGTCAAGTCCAACAGAGAATTCTTTTA
CCTTGGATGCTGACTTCTACCCAACTTTCTTGTACAAAGTGGTGGTACCT
CGAAGTTCCTATTCTCTACTTAGTATAGGAACTTCCATCCTTGGAGCTCC
TTCAGGAGGCGGTGCTACTGCTGGCGCTGGTGGAGCCGGTGGACCTGCGG
GGTTAATTTACCCATACGATGTTCCTGACTATGCGGGCTATCCCTATGAC
GTCCCGGACTATGCAGGATCCTATCCATATGACGTTCCAGATTACGCTTG
A
MLSLRVPLAPITDPQQLQLSPLKGLSLVDKENTPPALSGTRVLASKTARR
IFQEPTEPKTKAAAPGVEDEPLLRENPRRFVIFPIEYHDIWQMYKKAEAS
FWTAEEVDLSKDIQHWESLKPEERYFISHVLAFFAASDGIVNENLVERFS
QEVQITEARCFYGFQIAMENIHSEMYSLLIDTYIKDPKEREFLFNAIETM
PCVKKKADWALRWIGDKEATYGERVVAFAAVEGIFFSGSFASIFWLKKRG
LMPGLTFSNELISRDEGLHCDFACLMFKHLVHKPSEERVREIIINAVRIE
QEFLTEALPVKLIGMNCTLMKQYIEFVADRLMLELGFSKVFRVENPFDFM
ENISLEGKTNFFEKRVGEYQRMGVMSSPTENSFTLDADFYPTFLYKVVVP
RSSYSLLSIGTSILGAPSGGGATAGAGGAGGPAGLIYPYDVPDYAGYPYD
VPDYAGSYPYDVPDYA*

Index