Stock Number Hs1462

Human Gene: DGAT2


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
DGAT2 diacylglycerol O-acyltransferase 2 HGNC:16940 11q13.5 Dgat2 2R

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03630 pGW-HA.attB ENST00000376262.7 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK33166204884854

Sequences

DNA sequence (1398 bp) Protein sequence (466 aa)
ATGAAGACCCTCATAGCCGCCTACTCCGGGGTCCTGCGCGGCGAGCGTCA
GGCCGAGGCTGACCGGAGCCAGCGCTCTCACGGAGGACCTGCGCTGTCGC
GCGAGGGGTCTGGGAGATGGGGCACTGGATCCAGCATCCTCTCCGCCCTC
CAGGACCTCTTCTCTGTCACCTGGCTCAATAGGTCCAAGGTGGAAAAGCA
GCTACAGGTCATCTCAGTGCTCCAGTGGGTCCTGTCCTTCCTTGTACTGG
GAGTGGCCTGCAGTGCCATCCTCATGTACATATTCTGCACTGATTGCTGG
CTCATCGCTGTGCTCTACTTCACTTGGCTGGTGTTTGACTGGAACACACC
CAAGAAAGGTGGCAGGAGGTCACAGTGGGTCCGAAACTGGGCTGTGTGGC
GCTACTTTCGAGACTACTTTCCCATCCAGCTGGTGAAGACACACAACCTG
CTGACCACCAGGAACTATATCTTTGGATACCACCCCCATGGTATCATGGG
CCTGGGTGCCTTCTGCAACTTCAGCACAGAGGCCACAGAAGTGAGCAAGA
AGTTCCCAGGCATACGGCCTTACCTGGCTACACTGGCAGGCAACTTCCGA
ATGCCTGTGTTGAGGGAGTACCTGATGTCTGGAGGTATCTGCCCTGTCAG
CCGGGACACCATAGACTATTTGCTTTCAAAGAATGGGAGTGGCAATGCTA
TCATCATCGTGGTCGGGGGTGCGGCTGAGTCTCTGAGCTCCATGCCTGGC
AAGAATGCAGTCACCCTGCGGAACCGCAAGGGCTTTGTGAAACTGGCCCT
GCGTCATGGAGCTGACCTGGTTCCCATCTACTCCTTTGGAGAGAATGAAG
TGTACAAGCAGGTGATCTTCGAGGAGGGCTCCTGGGGCCGATGGGTCCAG
AAGAAGTTCCAGAAATACATTGGTTTCGCCCCATGCATCTTCCATGGTCG
AGGCCTCTTCTCCTCCGACACCTGGGGGCTGGTGCCCTACTCCAAGCCCA
TCACCACTGTTGTGGGAGAGCCCATCACCATCCCCAAGCTGGAGCACCCA
ACCCAGCAAGACATCGACCTGTACCACACCATGTACATGGAGGCCCTGGT
GAAGCTCTTCGACAAGCACAAGACCAAGTTCGGCCTCCCGGAGACTGAGG
TCCTGGAGGTGAACTGCCCAACTTTCTTGTACAAAGTGGTGGTACCTCGA
AGTTCCTATTCTCTACTTAGTATAGGAACTTCCATCCTTGGAGCTCCTTC
AGGAGGCGGTGCTACTGCTGGCGCTGGTGGAGCCGGTGGACCTGCGGGGT
TAATTTACCCATACGATGTTCCTGACTATGCGGGCTATCCCTATGACGTC
CCGGACTATGCAGGATCCTATCCATATGACGTTCCAGATTACGCTTGA
MKTLIAAYSGVLRGERQAEADRSQRSHGGPALSREGSGRWGTGSSILSAL
QDLFSVTWLNRSKVEKQLQVISVLQWVLSFLVLGVACSAILMYIFCTDCW
LIAVLYFTWLVFDWNTPKKGGRRSQWVRNWAVWRYFRDYFPIQLVKTHNL
LTTRNYIFGYHPHGIMGLGAFCNFSTEATEVSKKFPGIRPYLATLAGNFR
MPVLREYLMSGGICPVSRDTIDYLLSKNGSGNAIIIVVGGAAESLSSMPG
KNAVTLRNRKGFVKLALRHGADLVPIYSFGENEVYKQVIFEEGSWGRWVQ
KKFQKYIGFAPCIFHGRGLFSSDTWGLVPYSKPITTVVGEPITIPKLEHP
TQQDIDLYHTMYMEALVKLFDKHKTKFGLPETEVLEVNCPTFLYKVVVPR
SSYSLLSIGTSILGAPSGGGATAGAGGAGGPAGLIYPYDVPDYAGYPYDV
PDYAGSYPYDVPDYA*

Index