Stock Number Hs1461

Human Gene: LANCL3


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
LANCL3 LanC like 3 HGNC:24767 Xp21.1 CG2061 X

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03629 pGW-HA.attB ENST00000378621.7 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK37166204784853

Sequences

DNA sequence (1398 bp) Protein sequence (466 aa)
ATGGACACCAAGCGCTGCTTCGCCAATCGCTTCGATGACTACCAGGGCAG
CCTGCTGGCGGGCCAGTGTGAGGAGGCGGTGGCGCCCTTGGTCACCGCCA
CCATCGAGCGCATCCTCCAGGAGCTTCCCCCACTCGGGGGCGGCGCGGAG
GCCCGAGGGGCGACGGCGGGGGCTAGCGCCTGCCAGGGGGGGCTTTATGG
CGGCGTGGCCGGAGTGGCGTATATGCTCTACCACGTCTCGCAGAGCCCGC
TTTTCGCCACGGCCCGGGAACGCTACCTGCGCTCGGCTAAGCGCCTCATC
GACGCGTGCGCCCGCGCTGAGGAGTGGGGCGAACCGGACGCCGACACCCG
CGCCGCCTTCCTGCTCGGGGGCGCGGGCGTGTACGCCGTGGCCACGCTCG
TATACCACGCCCTGGGCCGGTCCGACTACGTGCAGCCGCTGGGCAAGTTC
CGGGCTCTGTGTGCCGTCTGCGCGCCGGTCTCCTTCCTGGAGTGCGGCTC
CGACGAGCTGTTCGTGGGCCGCGCGGGTTACCTGTGTGCCGCGCTGGTGC
TCAAGCAGAAACTCGCCCAGGAGGTGCTGACTCCAGCACAGATCAAGTCA
ATTTGTCAGGCAATTCTGGACTCTGGGAAGCAGTATGCCATAAAGAAGAG
GAAACCATTCCCCCTGATGTATTCTTACTATGGAACCGAATACTTGGGGG
CAGCTCACGGCTTGTCGTCTATTCTTCAGATGCTTCTTTCTTACCATGAG
CATCTCAAGCCCTCAGATCGGGAATTGGTATGGCAGAGCGTGGACTTTCT
CATGGAACAGGAACAAAACTGCAACTGGCCACCTGAGCTCGGCGAGACCA
TCGAGAGAGAGAATGAGCTGGTGCACTGGTGCCATGGCGCTCCAGGAATT
GCCTATCTGTTTGCCAAAGCTTATCTGGTTTCCAAGAAACCGCAGTACCT
GGACACATGTATTCGGTGTGGGGAACTCACATGGCAGAAAGGCCTGCTAA
AGAAGGGGCCTGGGATTTGCCATGGAGTAGCCGGCAGTGCCTATGTCTTC
CTGCTGCTGTACCGGCTCACGGGAAACTCTAAATACATCTACCGAGCTCA
AAGTTCATTCCCTGTAAACTTGATAAAGATGGAACATCTGCTGTATACCA
GACAACATTGCTTTTTGCCAACTTTCTTGTACAAAGTGGTGGTACCTCGA
AGTTCCTATTCTCTACTTAGTATAGGAACTTCCATCCTTGGAGCTCCTTC
AGGAGGCGGTGCTACTGCTGGCGCTGGTGGAGCCGGTGGACCTGCGGGGT
TAATTTACCCATACGATGTTCCTGACTATGCGGGCTATCCCTATGACGTC
CCGGACTATGCAGGATCCTATCCATATGACGTTCCAGATTACGCTTGA
MDTKRCFANRFDDYQGSLLAGQCEEAVAPLVTATIERILQELPPLGGGAE
ARGATAGASACQGGLYGGVAGVAYMLYHVSQSPLFATARERYLRSAKRLI
DACARAEEWGEPDADTRAAFLLGGAGVYAVATLVYHALGRSDYVQPLGKF
RALCAVCAPVSFLECGSDELFVGRAGYLCAALVLKQKLAQEVLTPAQIKS
ICQAILDSGKQYAIKKRKPFPLMYSYYGTEYLGAAHGLSSILQMLLSYHE
HLKPSDRELVWQSVDFLMEQEQNCNWPPELGETIERENELVHWCHGAPGI
AYLFAKAYLVSKKPQYLDTCIRCGELTWQKGLLKKGPGICHGVAGSAYVF
LLLYRLTGNSKYIYRAQSSFPVNLIKMEHLLYTRQHCFLPTFLYKVVVPR
SSYSLLSIGTSILGAPSGGGATAGAGGAGGPAGLIYPYDVPDYAGYPYDV
PDYAGSYPYDVPDYA*

Index