Stock Number Hs1460

Human Gene: SSBP3


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
SSBP3 single stranded DNA binding protein 3 HGNC:15674 1p32.3 Ssdp 3R

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03628 pGW-HA.attB ENST00000357475.8 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK37166204684852

Sequences

DNA sequence (1398 bp) Protein sequence (466 aa)
ATGTTTGCCAAAGGCAAAGGCTCGGCGGTGCCCTCGGATGGGCAGGCTCG
GGAAAAGTTAGCTTTATACGTCTACGAATATTTACTGCACGTAGGAGCAC
AGAAATCTGCACAGACCTTCTTATCGGAGATTCGATGGGAAAAAAACATC
ACGTTGGGAGAACCGCCTGGGTTTTTGCACTCGTGGTGGTGTGTATTTTG
GGACCTTTACTGTGCAGCTCCTGAAAGGAGAGACACTTGTGAACATTCAA
GTGAAGCAAAAGCCTTTCATGATTATAGTGCAGCAGCTGCCCCGAGCCCC
GTGCTTGGCAACATTCCCCCCAACGATGGGATGCCGGGAGGCCCCATCCC
GCCAGGTTTCTTTCAGGGTCCTCCGGGGTCACAGCCCTCGCCGCACGCAC
AGCCTCCACCTCACAATCCTAGCAGCATGATGGGACCCCACAGTCAGCCT
TTTATGTCACCGCGATACGCAGGCGGCCCCAGGCCCCCGATCAGAATGGG
AAACCAGCCTCCGGGAGGAGTTCCTGGGACACAGCCATTGCTGCCCAATT
CTATGGATCCCACACGACAACAAGGCCACCCCAACATGGGAGGATCAATG
CAGAGAATGAACCCTCCCCGAGGCATGGGGCCCATGGGTCCCGGCCCACA
GAATTACGGCAGCGGCATGAGACCACCACCCAACTCCCTCGGCCCCGCCA
TGCCCGGGATTAACATGGGCCCGGGAGCTGGCAGACCCTGGCCCAATCCT
AACAGTGCTAACTCAATTCCATACTCCTCCTCATCACCTGGTACCTATGT
GGGACCCCCTGGTGGTGGCGGTCCTCCAGGAACACCCATTATGCCCAGTC
CCGCAGATTCAACAAATTCCAGTGACAACATCTACACAATGATTAATCCA
GTGCCGCCTGGAGGCAGCCGGTCCAACTTCCCGATGGGTCCCGGCTCGGA
CGGTCCGATGGGCGGCATGGGTGGCATGGAGCCACACCACATGAATGGAT
CATTAGGGTCAGGCGACATAGACGGACTTCCAAAAAATTCTCCTAACAAC
ATAAGTGGCATTAGCAATCCTCCAGGCACCCCTCGAGATGACGGCGAGCT
AGGAGGGAACTTCCTCCACTCCTTTCAGAACGACAATTATTCTCCAAGCA
TGACGATGAGTGTGTGCCCAACTTTCTTGTACAAAGTGGTGGTACCTCGA
AGTTCCTATTCTCTACTTAGTATAGGAACTTCCATCCTTGGAGCTCCTTC
AGGAGGCGGTGCTACTGCTGGCGCTGGTGGAGCCGGTGGACCTGCGGGGT
TAATTTACCCATACGATGTTCCTGACTATGCGGGCTATCCCTATGACGTC
CCGGACTATGCAGGATCCTATCCATATGACGTTCCAGATTACGCTTGA
MFAKGKGSAVPSDGQAREKLALYVYEYLLHVGAQKSAQTFLSEIRWEKNI
TLGEPPGFLHSWWCVFWDLYCAAPERRDTCEHSSEAKAFHDYSAAAAPSP
VLGNIPPNDGMPGGPIPPGFFQGPPGSQPSPHAQPPPHNPSSMMGPHSQP
FMSPRYAGGPRPPIRMGNQPPGGVPGTQPLLPNSMDPTRQQGHPNMGGSM
QRMNPPRGMGPMGPGPQNYGSGMRPPPNSLGPAMPGINMGPGAGRPWPNP
NSANSIPYSSSSPGTYVGPPGGGGPPGTPIMPSPADSTNSSDNIYTMINP
VPPGGSRSNFPMGPGSDGPMGGMGGMEPHHMNGSLGSGDIDGLPKNSPNN
ISGISNPPGTPRDDGELGGNFLHSFQNDNYSPSMTMSVCPTFLYKVVVPR
SSYSLLSIGTSILGAPSGGGATAGAGGAGGPAGLIYPYDVPDYAGYPYDV
PDYAGSYPYDVPDYA*

Index