Stock Number Hs1459

Human Gene: GRK3


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
GRK3 G protein-coupled receptor kinase 3 HGNC:290 22q12.1 Gprk1 2R

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03627 pGW-HA.attB Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK33166204584851

Sequences

DNA sequence (1395 bp) Protein sequence (465 aa)
ATGGCGGACCTGGAGGCTGTGCTGGCCGATGTCAGTTACCTGATGGCCAT
GGAGAAGAGCAAGGCGACCCCGGCCGCCCGCGCCAGCAAGAGGATCGTCC
TGCCGGAGCCCAGTATCCGGAGTGTGATGCAGAAGTACCTTGCAGAGAGA
AATGAAATAACCTTTGACAAGATTTTCAATCAGAAAATTGGTTTCTTGCT
ATTTAAAGATTTTTGTTTGAATGAAATTAATGAAGCTGTACCTCAGGTGA
AGTTTTATGAAGAGATAAAGGAATATGAAAAACTTGATAATGAGGAAGAC
CGCCTTTGCAGAAGTCGACAAATTTATGATGCCTACATCATGAAGGAACT
TCTTTCCTGTTCACATCCTTTCTCAAAGCAAGCTGTAGAACACGTACAAA
GTCATTTATCCAAGAAACAAGTGACATCAACTCTTTTTCAGCCATACATA
GAAGAAATTTGTGAAAGCCTTCGAGGTGACATTTTTCAAAAATTTATGGA
AAGTGACAAGTTCACTAGATTTTGTCAGTGGAAAAACGTTGAATTAAATA
TCCATTTGACCATGAATGAGTTCAGTGTGCATAGGATTATTGGACGAGGA
GGATTCGGGGAAGTTTATGGTTGCAGGAAAGCAGACACTGGAAAAATGTA
TGCAATGAAATGCTTAGATAAGAAGAGGATCAAAATGAAACAAGGAGAAA
CATTAGCCTTAAATGAAAGAATCATGTTGTCTCTTGTCAGCACAGGAGAC
TGTCCTTTCATTGTATGTATGACCTATGCCTTCCATACCCCAGATAAACT
CTGCTTCATCCTGGATCTGATGAACGGGGGCGATTTGCACTACCACCTTT
CACAACACGGTGTGTTCTCTGAGAAGGAGATGCGGTTTTATGCCACTGAA
ATCATTCTGGGTCTGGAACACATGCACAATCGGTTTGTTGTCTACAGAGA
TTTGAAGCCAGCAAATATTCTCTTGGATGAACATGGACACGCAAGAATAT
CAGATCTTGGTCTTGCCTGCGATTTTTCCAAAAAGAAGCCTCATGCGAGT
GTTGGCACCCATGGGTACATGGCTCCCGAGGTGCTGCAGAAGGGGACGGC
CTATGACAGCAGTGCCGACTGGTTCTCCCTGGGCTGCATGCTTTTCAAAC
TTCTGAGAGGATGCCCAACTTTCTTGTACAAAGTGGTGGTACCTCGAAGT
TCCTATTCTCTACTTAGTATAGGAACTTCCATCCTTGGAGCTCCTTCAGG
AGGCGGTGCTACTGCTGGCGCTGGTGGAGCCGGTGGACCTGCGGGGTTAA
TTTACCCATACGATGTTCCTGACTATGCGGGCTATCCCTATGACGTCCCG
GACTATGCAGGATCCTATCCATATGACGTTCCAGATTACGCTTGA
MADLEAVLADVSYLMAMEKSKATPAARASKRIVLPEPSIRSVMQKYLAER
NEITFDKIFNQKIGFLLFKDFCLNEINEAVPQVKFYEEIKEYEKLDNEED
RLCRSRQIYDAYIMKELLSCSHPFSKQAVEHVQSHLSKKQVTSTLFQPYI
EEICESLRGDIFQKFMESDKFTRFCQWKNVELNIHLTMNEFSVHRIIGRG
GFGEVYGCRKADTGKMYAMKCLDKKRIKMKQGETLALNERIMLSLVSTGD
CPFIVCMTYAFHTPDKLCFILDLMNGGDLHYHLSQHGVFSEKEMRFYATE
IILGLEHMHNRFVVYRDLKPANILLDEHGHARISDLGLACDFSKKKPHAS
VGTHGYMAPEVLQKGTAYDSSADWFSLGCMLFKLLRGCPTFLYKVVVPRS
SYSLLSIGTSILGAPSGGGATAGAGGAGGPAGLIYPYDVPDYAGYPYDVP
DYAGSYPYDVPDYA*

Index