Stock Number Hs1457

Human Gene: SGCA


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
SGCA sarcoglycan alpha HGNC:10805 17q21.33 Scgalpha 2L

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03625 pGW-HA.attB ENST00000262018.7 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK33166204384849

Sequences

DNA sequence (1395 bp) Protein sequence (465 aa)
ATGGCTGAGACACTCTTCTGGACTCCTCTCCTCGTGGTTCTCCTGGCAGG
GCTGGGGGACACCGAGGCCCAGCAGACCACGCTACACCCACTTGTGGGCC
GTGTCTTTGTGCACACCTTGGACCATGAGACGTTTCTGAGCCTTCCTGAG
CATGTCGCTGTCCCACCCGCTGTCCACATCACCTACCACGCCCACCTCCA
GGGACACCCAGACCTGCCCCGGTGGCTCCGCTACACCCAGCGCAGCCCCC
ACCACCCTGGCTTCCTCTACGGCTCTGCCACCCCAGAAGATCGTGGGCTC
CAGGTCATTGAGGTCACAGCCTACAATCGGGACAGCTTTGATACCACTCG
GCAGAGGCTGGTGCTGGAGATTGGGGACCCAGAAGGCCCCCTGCTGCCAT
ACCAAGCCGAGTTCCTGGTGCGCAGCCACGATGCGGAGGAGGTGCTGCCC
TCAACACCTGCCAGCCGCTTCCTCTCAGCCTTGGGGGGACTCTGGGAGCC
CGGAGAGCTTCAGCTGCTCAACGTCACCTCTGCCTTGGACCGTGGGGGCC
GTGTCCCCCTTCCCATTGAGGGCCGAAAAGAAGGGGTATACATTAAGGTG
GGTTCTGCCTCACCTTTTTCTACTTGCCTGAAGATGGTGGCATCCCCCGA
TAGCCACGCCCGCTGTGCCCAGGGCCAGCCTCCACTTCTGTCTTGCTACG
ACACCTTGGCACCCCACTTCCGCGTTGACTGGTGCAATGTGACCCTGGTG
GATAAGTCAGTGCCGGAGCCTGCAGATGAGGTGCCCACCCCAGGTGATGG
GATCCTGGAGCATGACCCGTTCTTCTGCCCACCCACTGAGGCCCCAGACC
GTGACTTCTTGGTGGATGCTCTGGTCACCCTCCTGGTGCCCCTGCTGGTG
GCCCTGCTTCTCACCTTGCTGCTGGCCTATGTCATGTGCTGCCGGCGGGA
GGGAAGGCTGAAGAGAGACCTGGCTACCTCCGACATCCAGATGGTCCACC
ACTGCACCATCCACGGGAACACAGAGGAGCTGCGGCAGATGGCGGCCAGC
CGCGAGGTGCCCCGGCCACTCTCCACCCTGCCCATGTTCAATGTGCACAC
AGGTGAGCGGCTGCCTCCCCGCGTGGACAGCGCCCAGGTGCCCCTCATTC
TGGACCAGCACTGCCCAACTTTCTTGTACAAAGTGGTGGTACCTCGAAGT
TCCTATTCTCTACTTAGTATAGGAACTTCCATCCTTGGAGCTCCTTCAGG
AGGCGGTGCTACTGCTGGCGCTGGTGGAGCCGGTGGACCTGCGGGGTTAA
TTTACCCATACGATGTTCCTGACTATGCGGGCTATCCCTATGACGTCCCG
GACTATGCAGGATCCTATCCATATGACGTTCCAGATTACGCTTGA
MAETLFWTPLLVVLLAGLGDTEAQQTTLHPLVGRVFVHTLDHETFLSLPE
HVAVPPAVHITYHAHLQGHPDLPRWLRYTQRSPHHPGFLYGSATPEDRGL
QVIEVTAYNRDSFDTTRQRLVLEIGDPEGPLLPYQAEFLVRSHDAEEVLP
STPASRFLSALGGLWEPGELQLLNVTSALDRGGRVPLPIEGRKEGVYIKV
GSASPFSTCLKMVASPDSHARCAQGQPPLLSCYDTLAPHFRVDWCNVTLV
DKSVPEPADEVPTPGDGILEHDPFFCPPTEAPDRDFLVDALVTLLVPLLV
ALLLTLLLAYVMCCRREGRLKRDLATSDIQMVHHCTIHGNTEELRQMAAS
REVPRPLSTLPMFNVHTGERLPPRVDSAQVPLILDQHCPTFLYKVVVPRS
SYSLLSIGTSILGAPSGGGATAGAGGAGGPAGLIYPYDVPDYAGYPYDVP
DYAGSYPYDVPDYA*

Index