Stock Number Hs1456

Human Gene: CERS3


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
CERS3 ceramide synthase 3 HGNC:23752 15q26.3 schlank X

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03611 pGW-HA.attB ENST00000558884.6 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK37166204284848

Sequences

DNA sequence (1383 bp) Protein sequence (461 aa)
ATGTTTTGGACGTTTAAAGAATGGTTCTGGTTGGAAAGATTCTGGCTTCC
TCCAACAATAAAGTGGTCAGATCTTGAGGATCACGATGGACTCGTCTTTG
TAAAACCTTCTCATTTATACGTGACAATTCCATATGCTTTTCTCTTGCTG
ATTATCAGGCGTGTATTTGAAAAATTTGTTGCTTCACCTCTAGCAAAATC
ATTTGGCATTAAAGAGACAGTTCGAAAGGTTACACCAAATACTGTCTTAG
AGAATTTTTTCAAACATTCCACAAGGCAACCATTGCAAACTGATATTTAT
GGACTGGCAAAGAAGTGTAACTTGACGGAGCGCCAGGTGGAAAGATGGTT
TAGGAGTCGGCGGAATCAAGAGAGGCCTTCCAGGCTGAAGAAATTCCAGG
AAGCTTGCTGGAGATTTGCATTTTACTTAATGATCACTGTTGCTGGAATT
GCGTTTCTTTATGATAAACCTTGGCTATATGACTTATGGGAGGTTTGGAA
TGGCTATCCCAAACAGCCCCTGCTGCCATCCCAGTACTGGTACTACATTT
TAGAAATGAGTTTTTATTGGTCTCTGTTATTTAGACTTGGCTTTGATGTC
AAGAGAAAGGATTTTCTAGCTCATATCATCCACCACCTGGCTGCTATTAG
TCTGATGAGCTTCTCTTGGTGTGCTAATTATATTCGCAGTGGGACCCTCG
TGATGATTGTACACGATGTGGCTGACATTTGGCTGGAGTCTGCTAAGATG
TTTTCTTATGCTGGATGGACGCAGACCTGTAACACCCTGTTTTTCATCTT
CTCCACCATATTTTTCATCAGCCGCCTCATTGTTTTTCCTTTCTGGATTT
TATATTGCACGCTGATCTTGCCTATGTATCACCTCGAGCCTTTCTTTTCA
TACATCTTCCTCAACCTACAGCTCATGATCTTGCAGGTCCTTCACCTTTA
CTGGGGTTATTACATCTTGAAGATGCTCAACAGATGTATATTCATGAAGA
GCATCCAGGATGTGAGGAGTGATGACGAGGATTATGAAGAGGAAGAGGAA
GAGGAAGAAGAAGAGGCTACCAAAGGCAAAGAGATGGATTGTTTAAAGAA
CGGCCTCGGGGCTGAGAGGCACCTCATTCCCAATGGCCAGCATGGCCATT
ACCCAACTTTCTTGTACAAAGTGGTGGTACCTCGAAGTTCCTATTCTCTA
CTTAGTATAGGAACTTCCATCCTTGGAGCTCCTTCAGGAGGCGGTGCTAC
TGCTGGCGCTGGTGGAGCCGGTGGACCTGCGGGGTTAATTTACCCATACG
ATGTTCCTGACTATGCGGGCTATCCCTATGACGTCCCGGACTATGCAGGA
TCCTATCCATATGACGTTCCAGATTACGCTTGA
MFWTFKEWFWLERFWLPPTIKWSDLEDHDGLVFVKPSHLYVTIPYAFLLL
IIRRVFEKFVASPLAKSFGIKETVRKVTPNTVLENFFKHSTRQPLQTDIY
GLAKKCNLTERQVERWFRSRRNQERPSRLKKFQEACWRFAFYLMITVAGI
AFLYDKPWLYDLWEVWNGYPKQPLLPSQYWYYILEMSFYWSLLFRLGFDV
KRKDFLAHIIHHLAAISLMSFSWCANYIRSGTLVMIVHDVADIWLESAKM
FSYAGWTQTCNTLFFIFSTIFFISRLIVFPFWILYCTLILPMYHLEPFFS
YIFLNLQLMILQVLHLYWGYYILKMLNRCIFMKSIQDVRSDDEDYEEEEE
EEEEEATKGKEMDCLKNGLGAERHLIPNGQHGHYPTFLYKVVVPRSSYSL
LSIGTSILGAPSGGGATAGAGGAGGPAGLIYPYDVPDYAGYPYDVPDYAG
SYPYDVPDYA*

Index