Stock Number Hs1455

Human Gene: ADH7


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
ADH7 alcohol dehydrogenase 7 (class IV), mu or sigma polypeptide HGNC:256 4q23 Fdh 3R

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03620 pGW-HA.attB ENST00000474027.1 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK37166204184847

Sequences

DNA sequence (1392 bp) Protein sequence (464 aa)
ATGTTTGCAGAAATACAGATCCAAGACAAAGACAGGATGGGCACTGCTGG
AAAAGTTATTAAATGCAAAGCAGCTGTGCTTTGGGAGCAGAAGCAACCCT
TCTCCATTGAGGAAATAGAAGTTGCCCCACCAAAGACTAAAGAAGTTCGC
ATTAAGATTTTGGCCACAGGAATCTGTCGCACAGATGACCATGTGATAAA
AGGAACAATGGTGTCCAAGTTTCCAGTGATTGTGGGACATGAGGCAACTG
GGATTGTAGAGAGCATTGGAGAAGGAGTGACTACAGTGAAACCAGGTGAC
AAAGTCATCCCTCTCTTTCTGCCACAATGTAGAGAATGCAATGCTTGTCG
CAACCCAGATGGCAACCTTTGCATTAGGAGCGATATTACTGGTCGTGGAG
TACTGGCTGATGGCACCACCAGATTTACATGCAAGGGCAAACCAGTCCAC
CACTTCATGAACACCAGTACATTTACCGAGTACACAGTGGTGGATGAATC
TTCTGTTGCTAAGATTGATGATGCAGCTCCTCCTGAGAAAGTCTGTTTAA
TTGGCTGTGGGTTTTCCACTGGATATGGCGCTGCTGTTAAAACTGGCAAG
GTCAAACCTGGTTCCACTTGCGTCGTCTTTGGCCTGGGAGGAGTTGGCCT
GTCAGTCATCATGGGCTGTAAGTCAGCTGGTGCATCTAGGATCATTGGGA
TTGACCTCAACAAAGACAAATTTGAGAAGGCCATGGCTGTAGGTGCCACT
GAGTGTATCAGTCCCAAGGACTCTACCAAACCCATCAGTGAGGTGCTGTC
AGAAATGACAGGCAACAACGTGGGATACACCTTTGAAGTTATTGGGCATC
TTGAAACCATGATTGATGCCCTGGCATCCTGCCACATGAACTATGGGACC
AGCGTGGTTGTAGGAGTTCCTCCATCAGCCAAGATGCTCACCTATGACCC
GATGTTGCTCTTCACTGGACGCACATGGAAGGGATGTGTCTTTGGAGGTT
TGAAAAGCAGAGATGATGTCCCAAAACTAGTGACTGAGTTCCTGGCAAAG
AAATTTGACCTGGACCAGTTGATAACTCATGTTTTACCATTTAAAAAAAT
CAGTGAAGGATTTGAGCTGCTCAATTCAGGACAAAGCATTCGAACGGTCC
TGACGTTTTTGCCAACTTTCTTGTACAAAGTGGTGGTACCTCGAAGTTCC
TATTCTCTACTTAGTATAGGAACTTCCATCCTTGGAGCTCCTTCAGGAGG
CGGTGCTACTGCTGGCGCTGGTGGAGCCGGTGGACCTGCGGGGTTAATTT
ACCCATACGATGTTCCTGACTATGCGGGCTATCCCTATGACGTCCCGGAC
TATGCAGGATCCTATCCATATGACGTTCCAGATTACGCTTGA
MFAEIQIQDKDRMGTAGKVIKCKAAVLWEQKQPFSIEEIEVAPPKTKEVR
IKILATGICRTDDHVIKGTMVSKFPVIVGHEATGIVESIGEGVTTVKPGD
KVIPLFLPQCRECNACRNPDGNLCIRSDITGRGVLADGTTRFTCKGKPVH
HFMNTSTFTEYTVVDESSVAKIDDAAPPEKVCLIGCGFSTGYGAAVKTGK
VKPGSTCVVFGLGGVGLSVIMGCKSAGASRIIGIDLNKDKFEKAMAVGAT
ECISPKDSTKPISEVLSEMTGNNVGYTFEVIGHLETMIDALASCHMNYGT
SVVVGVPPSAKMLTYDPMLLFTGRTWKGCVFGGLKSRDDVPKLVTEFLAK
KFDLDQLITHVLPFKKISEGFELLNSGQSIRTVLTFLPTFLYKVVVPRSS
YSLLSIGTSILGAPSGGGATAGAGGAGGPAGLIYPYDVPDYAGYPYDVPD
YAGSYPYDVPDYA*

Index