Stock Number Hs1454

Human Gene: GFOD1


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
GFOD1 glucose-fructose oxidoreductase domain containing 1 HGNC:21096 6p24.1-p23 CG17712 2L

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03735 pGW-HA.attB ENST00000379284.1 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK33166204084846

Sequences

DNA sequence (1404 bp) Protein sequence (468 aa)
ATGCTTCCCGGGGTGGGCGTGTTCGGCACCAGCCTCACGGCCCGTGTCAT
CATCCCGCTGCTGAAAGACGAGGGCTTCGCGGTGAAGGCGCTGTGGGGCC
GCACGCAGGAAGAAGCGGAGGAGCTGGCCAAGGAGATGAGTGTCCCCTTC
TACACTAGCCGCATTGATGAGGTGCTGCTGCATCAGGACGTGGACTTGGT
GTGCATTAACCTGCCGCCGCCCCTCACCAGACAGATCGCTGTCAAAACCC
TAGGCATCGGCAAGAACGTCATCTGCGACCGCACGGCCACGCCGCTGGAC
GCTTTCCGCATGACCTCGGCCGCCCACTACTACCCCAAGCTCATGAGCAT
CATGGGCAACGTGCTGCGCTTCCTGCCGGCTTTCGTGCGCATGAAGCAGC
TGATCGAGGAGGGCTACGTGGGCGAGCCGCTGGTGTGTGAGGTGCAGGTG
CACGGCGGCAGCCTGCTGGGCAAGAAGTACAACTGGAGCTGCGACGACTT
GATGGGCGGCGGCGGCCTGCACTCCGTGGGCACCTACATCATCGACCTGC
TCACCTTCCTCACCGGCCAAAAGGCCGTCAAGGTCCACGGGCTGCTCAAG
ACCTTCGTGAAGCAGACTGACCACATCAAGGGCATCCGACAGATCACCAG
CGATGACTTCTGCACCTTCCAGATGGTGCTGGAGGGCGGGGTGTGCTGCA
CCGTCACCCTCAACTTCAACGTGCCCGGCGAGTTCAAGCAGGATGTCACT
GTGGTGGGCTCAGCCGGGCGCCTGCTGGCCGTGGGCACCGACCTGTACGG
GCAGCGCAACAGCGCCCCGGAGCAGGAGCTGCTGGTGCAGGACGCCACGC
CGGTGAGCAACTCCCTGCTTCCGGAGAAGGCCTTCAGCGACATCCCCTCG
CCCTACCTGCGCGGCACCATCAAGATGATGCAGGCGGTGCGCCAGGCCTT
CCAGGACCAGGACGACCGGCGCACGTGGGATGGGCGGCCCCTCACCATGG
CCGCCACCTTCGACGACTGCCTGTATGCCTTGTGCGTGGTGGACACCATC
AAGAGGTCCAGCCAGACGGGCGAGTGGCAGAACATTGCCATCATGACCGA
GGAGCCGGAGCTGAGCCCCGCCTACCTGATCAGCGAGGCCATGCGCCGCA
GCAGGATGTCCCTCTACTGTTTGCCAACTTTCTTGTACAAAGTGGTGGTA
CCTCGAAGTTCCTATTCTCTACTTAGTATAGGAACTTCCATCCTTGGAGC
TCCTTCAGGAGGCGGTGCTACTGCTGGCGCTGGTGGAGCCGGTGGACCTG
CGGGGTTAATTTACCCATACGATGTTCCTGACTATGCGGGCTATCCCTAT
GACGTCCCGGACTATGCAGGATCCTATCCATATGACGTTCCAGATTACGC
TTGA
MLPGVGVFGTSLTARVIIPLLKDEGFAVKALWGRTQEEAEELAKEMSVPF
YTSRIDEVLLHQDVDLVCINLPPPLTRQIAVKTLGIGKNVICDRTATPLD
AFRMTSAAHYYPKLMSIMGNVLRFLPAFVRMKQLIEEGYVGEPLVCEVQV
HGGSLLGKKYNWSCDDLMGGGGLHSVGTYIIDLLTFLTGQKAVKVHGLLK
TFVKQTDHIKGIRQITSDDFCTFQMVLEGGVCCTVTLNFNVPGEFKQDVT
VVGSAGRLLAVGTDLYGQRNSAPEQELLVQDATPVSNSLLPEKAFSDIPS
PYLRGTIKMMQAVRQAFQDQDDRRTWDGRPLTMAATFDDCLYALCVVDTI
KRSSQTGEWQNIAIMTEEPELSPAYLISEAMRRSRMSLYCLPTFLYKVVV
PRSSYSLLSIGTSILGAPSGGGATAGAGGAGGPAGLIYPYDVPDYAGYPY
DVPDYAGSYPYDVPDYA*

Index