Stock Number Hs1453

Human Gene: USP32


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
USP32 ubiquitin specific peptidase 32 HGNC:19143 17q23.3 Usp32 3L

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03734 pGW-HA.attB ENST00000393003.7 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK37166203984845

Sequences

DNA sequence (1404 bp) Protein sequence (468 aa)
ATGGGTGCCAAGGAGTCACGGATCGGATTCCTCAGCTACGAGGAGGCGCT
GAGGAGAGTTACAGATGTAGAGCTAAAACGACTGAAGGATGCTTTCAAGA
GGACCTGTGGACTCTCATATTACATGGGCCAGCACTGCTTCATCCGGGAA
GTGCTTGGGGATGGAGTGCCTCCAAAGGTTGCTGAGGTGATTTACTGTTC
TTTTGGTGGAACATCCAAAGGGCTGCACTTCAATAATTTAATAGTTGGAC
TTGTCCTCCTTACAAGAGGCAAAGATGAAGAGAAAGCAAAATACATTTTT
AGTCTTTTTTCAAGTGAATCTGGGAACTATGTTATACGGGAAGAAATGGA
AAGAATGCTCCACGTGGTGGATGGTAAAGTCCCAGATACACTCAGGAAGT
GTTTCTCAGAGGGTGAAAAGGTAAACTATGAAAAGTTTAGAAATTGGCTT
TTTCTAAACAAAGATGCTTTTACTTTCTCTCGATGGCTTCTATCTGGAGG
TGTGTATGTTACCCTCACTGATGATAGTGATACTCCTACTTTCTACCAAA
CTCTGGCTGGAGTCACACATTTGGAGGAATCAGACATCATTGATCTTGAG
AAACGCTATTGGTTATTGAAGGCTCAATCCCGGACTGGACGATTTGATTT
AGAGACATTTGGCCCATTGGTTTCACCACCTATTCGTCCATCTCTAAGTG
AAGGTTTGTTTAATGCTTTTGATGAAAATCGTGACAATCACATAGATTTT
AAGGAGATATCCTGTGGGTTATCAGCCTGTTGCAGGGGACCCCTGGCTGA
AAGACAAAAATTTTGCTTCAAGGTATTTGATGTTGACCGTGATGGAGTTC
TCTCCAGGGTTGAACTGAGAGACATGGTGGTTGCACTTTTAGAAGTCTGG
AAGGACAACCGCACTGATGATATTCCTGAATTACATATGGATCTCTCTGA
TATTGTAGAAGGCATACTGAATGCACATGACACCACAAAGATGGGTCATC
TTACTCTGGAAGACTATCAGATCTGGAGTGTGAAAAATGTTCTTGCCAAT
GAGTTTTTGAACCTCCTTTTCCAGGTGTGTCACATAGTTCTGGGGTTAAG
ACCAGCTACTCCGGAAGAAGAAGGACAAATTATTAGGACTCTGGAAACTG
ACCAAATATATACAAGAAATTGCCCAACTTTCTTGTACAAAGTGGTGGTA
CCTCGAAGTTCCTATTCTCTACTTAGTATAGGAACTTCCATCCTTGGAGC
TCCTTCAGGAGGCGGTGCTACTGCTGGCGCTGGTGGAGCCGGTGGACCTG
CGGGGTTAATTTACCCATACGATGTTCCTGACTATGCGGGCTATCCCTAT
GACGTCCCGGACTATGCAGGATCCTATCCATATGACGTTCCAGATTACGC
TTGA
MGAKESRIGFLSYEEALRRVTDVELKRLKDAFKRTCGLSYYMGQHCFIRE
VLGDGVPPKVAEVIYCSFGGTSKGLHFNNLIVGLVLLTRGKDEEKAKYIF
SLFSSESGNYVIREEMERMLHVVDGKVPDTLRKCFSEGEKVNYEKFRNWL
FLNKDAFTFSRWLLSGGVYVTLTDDSDTPTFYQTLAGVTHLEESDIIDLE
KRYWLLKAQSRTGRFDLETFGPLVSPPIRPSLSEGLFNAFDENRDNHIDF
KEISCGLSACCRGPLAERQKFCFKVFDVDRDGVLSRVELRDMVVALLEVW
KDNRTDDIPELHMDLSDIVEGILNAHDTTKMGHLTLEDYQIWSVKNVLAN
EFLNLLFQVCHIVLGLRPATPEEEGQIIRTLETDQIYTRNCPTFLYKVVV
PRSSYSLLSIGTSILGAPSGGGATAGAGGAGGPAGLIYPYDVPDYAGYPY
DVPDYAGSYPYDVPDYA*

Index